VDAC K12E mutant. Determined by X-ray diffraction at 2.6 Å resolution. Released 11 Jan 2023.
Explore 7TCV in 3D Show helices and sheets RCSB PDB PDBe
7TCV contains 3 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 12-19 | 8 | |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 38-48 | 11 | 1 |
| β-strand | 54-64 | 11 | 1 |
| α-helix | 65-67 | 3 | |
| β-strand | 69-76 | 8 | 1 |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 95-103 | 9 | 1 |
| β-strand | 110-120 | 11 | 1 |
| β-strand | 123-131 | 9 | 1 |
| β-strand | 137-146 | 10 | 1 |
| β-strand | 149-158 | 10 | 1 |
| β-strand | 163-174 | 12 | 1 |
| β-strand | 178-185 | 8 | 1 |
| β-strand | 189-197 | 9 | 1 |
| β-strand | 202-211 | 10 | 1 |
| β-strand | 218-228 | 11 | 1 |
| β-strand | 231-238 | 8 | 1 |
| β-strand | 243-252 | 10 | 1 |
| β-strand | 255-263 | 9 | 1 |
| β-strand | 274-282 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Voltage-dependent anion-selective channel protein 1 | XXX | protein | 295 | Mus musculus | Q60932 (AlphaFold model) |
>7TCV_1 Voltage-dependent anion-selective channel protein 1 (chains XXX) MRGSHHHHHHGSMAVPPTYADLGESARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSAN TETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTG KKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSN FAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVD PDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
| ID | Name | Formula | Copies |
|---|---|---|---|
| MC3 | 1,2-dimyristoyl-rac-glycero-3-phosphocholine | C36 H72 N O8 P | 1 |
Dynamical control of the mitochondrial beta-barrel channel VDAC by electrostatic and mechanical coupling. Ngo, V.A., Martin, M.Q., Khan, F. et al. To be published.
Other PDB entries of the same protein (UniProt Q60932 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7TCV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.