7TVG: SHOC2 to a resolution of 2.4 Angstrom

Crystal Structure of SHOC2 to a resolution of 2.4 Angstrom. Determined by X-ray diffraction at 2.4 Å resolution. Released 4 May 2022.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,809
Mol. weight: 57.28 kDa
Released: 4 May 2022

Explore 7TVG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TVG contains 21 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	87-100	14
β-strand	104-106	3	1
α-helix	117-121	5
β-strand	127-129	3	1
α-helix	140-144	5
β-strand	150-152	3	1
α-helix	163-167	5
β-strand	173-175	3	1
α-helix	188-190	3
β-strand	196-198	3	1
α-helix	209-213	5
β-strand	219-221	3	1
α-helix	232-236	5
β-strand	242-244	3	1
α-helix	255-259	5
β-strand	265-267	3	1
α-helix	278-282	5
β-strand	288-290	3	1
α-helix	301-305	5
β-strand	311-313	3	1
α-helix	326-329	4
β-strand	335-337	3	1
α-helix	346-348	3
α-helix	351-353	3
β-strand	359-361	3	1
α-helix	370-371	2
β-strand	383-385	3	1
α-helix	398-400	3
β-strand	406-408	3	1
α-helix	419-423	5
β-strand	429-431	3	1
α-helix	442-446	5
β-strand	452-454	3	1
α-helix	465-469	5
β-strand	475-477	3	1
α-helix	490-492	3
β-strand	498-500	3	1
α-helix	511-515	5
β-strand	521-523	3	1
α-helix	535-539	5
β-strand	545-547	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat protein SHOC-2	D	protein	507	Homo sapiens	Q9UQ13 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>7TVG_1 Leucine-rich repeat protein SHOC-2 (chains D)
GAAQPGVAFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPS
SIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLR
HNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGEL
CNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLS
AIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTI
YSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKI
PEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLV
LTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFEL
ALCSKLSIMSIENCPLSHLPPQIVAGG

Primary citation

Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome. Bonsor, D.A., Alexander, P., Snead, K. et al. Nat Struct Mol Biol (2022) 29:966-977. DOI 10.1038/s41594-022-00841-4 · PubMed

Other PDB entries of the same protein (UniProt Q9UQ13 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7T7A 1.79 Å, Crystal Structure of Human SHOC2: A Leucine-Rich Repeat Protein
7TYG 1.9 Å, Structure of the human leucine rich repeat protein SHOC2, residues 80-582
7TXH 1.95 Å, Human MRas Q71R in complex with human Shoc2 LRR domain M173I and human PP1Ca
9BTN 2.04 Å, Structure of human SHOC2 in complex with a cyclic peptide
7TVF 2.17 Å, Crystal structure of the SHOC2-MRAS-PP1CA (SMP) complex to a resolution of 2.17 Angstrom
9BTP 2.37 Å, Structure of human SHOC2 in complex with a small molecule inhibitor (S)-5
9OVJ 2.68 Å, Structure of human SHOC2 in complex with a small molecule inhibitor (R)-5
9BTM 2.73 Å, NRas 1-169 Q61R in Complex with Shoc2 80-582
7UPI 2.89 Å, Cryo-EM structure of SHOC2-PP1c-MRAS holophosphatase complex
7SD0 2.95 Å, Cryo-EM structure of the SHOC2:PP1C:MRAS complex
9O65 3.0 Å, Cryo-EM structure of SHOC2-KRAS-PP1CA (SKP) complex
7SD1 3.19 Å, Crystal structure of SHOC2

Browse structure collections

About this viewer

MolViewer shows 7TVG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.