Structure of human SHOC2 in complex with a small molecule inhibitor (S)-5. Determined by X-ray diffraction at 2.37 Å resolution. Released 2 Apr 2025.
Explore 9BTP in 3D Show helices and sheets RCSB PDB PDBe
9BTP contains 22 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 87-100 | 14 | |
| β-strand | 104-106 | 3 | 1 |
| α-helix | 117-121 | 5 | |
| β-strand | 127-129 | 3 | 1 |
| α-helix | 140-144 | 5 | |
| β-strand | 150-152 | 3 | 1 |
| α-helix | 163-167 | 5 | |
| β-strand | 173-175 | 3 | 1 |
| α-helix | 186-190 | 5 | |
| β-strand | 196-198 | 3 | 1 |
| α-helix | 209-213 | 5 | |
| β-strand | 219-221 | 3 | 1 |
| α-helix | 232-236 | 5 | |
| β-strand | 242-244 | 3 | 1 |
| α-helix | 255-259 | 5 | |
| β-strand | 265-267 | 3 | 1 |
| α-helix | 278-282 | 5 | |
| β-strand | 288-290 | 3 | 1 |
| α-helix | 301-305 | 5 | |
| β-strand | 311-313 | 3 | 1 |
| β-strand | 335-337 | 3 | 1 |
| α-helix | 346-347 | 2 | |
| α-helix | 351-354 | 4 | |
| β-strand | 359-361 | 3 | 1 |
| β-strand | 383-385 | 3 | 1 |
| α-helix | 398-400 | 3 | |
| β-strand | 406-408 | 3 | 1 |
| α-helix | 419-423 | 5 | |
| β-strand | 429-431 | 3 | 1 |
| α-helix | 442-446 | 5 | |
| β-strand | 452-454 | 3 | 1 |
| α-helix | 465-469 | 5 | |
| β-strand | 475-477 | 3 | 1 |
| α-helix | 488-492 | 5 | |
| β-strand | 498-500 | 3 | 1 |
| α-helix | 511-515 | 5 | |
| β-strand | 521-523 | 3 | 1 |
| α-helix | 535-539 | 5 | |
| β-strand | 545-547 | 3 | 1 |
| α-helix | 558-562 | 5 | |
| α-helix | 565-574 | 10 | |
| α-helix | 579-581 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leucine-rich repeat protein SHOC-2 | A | protein | 505 | Homo sapiens | Q9UQ13 (AlphaFold model) |
>9BTP_1 Leucine-rich repeat protein SHOC-2 (chains A) GPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQS LPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTL YLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEI GNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENN NISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSR AKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLL KKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLT HLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLP PQIVAGGPSFIIQFLKMQGPYRAMV
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1ATZ | (2S)-{2-[(4-chloro[1,1'-biphenyl]-3-yl)methoxy]phenyl}[(2-oxo-2,3-dihydro-1,3-b… | C28 H21 Cl N2 O5 | 1 |
Water and common crystallization additives (K) are not listed.
Targeting the SHOC2-RAS interaction in RAS-mutant cancers. Hauseman, Z.J., Stauffer, F., Beyer, K.S. et al. Nature (2025) 642:232-241. DOI 10.1038/s41586-025-08931-1 · PubMed
Other PDB entries of the same protein (UniProt Q9UQ13 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9BTP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.