7TWD: AAGAB C-terminal dimerization domain

Name: PDB 7TWD: Structure of AAGAB C-terminal dimerization domain
Published: 2023-01-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Structure of AAGAB C-terminal dimerization domain. Determined by X-ray diffraction at 2.11 Å resolution. Released 18 Jan 2023.

Method: X-ray diffraction
Resolution: 2.11 Å
Organism: Homo sapiens
Chains: 2
Atoms: 823
Mol. weight: 10.56 kDa
Ligands: PO4
Released: 18 Jan 2023

Explore 7TWD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TWD contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	258-299	42

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	258-298	41

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha- and gamma-adaptin-binding protein p34	A, B	protein	45	Homo sapiens	Q6PD74 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7TWD_1 Alpha- and gamma-adaptin-binding protein p34 (chains A, B)
SDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIGG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Primary citation

Oligomer-to-monomer transition underlies the chaperone function of AAGAB in AP1/AP2 assembly. Tian, Y., Datta, I., Yang, R. et al. Proc Natl Acad Sci U S A (2023) 120:e2205199120-e2205199120. DOI 10.1073/pnas.2205199120 · PubMed

Other PDB entries of the same protein (UniProt Q6PD74 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DDT 1.68 Å, AAGAB pseudoGTPase domain in complex with AP-1 clathrin adaptor complex sigma 3 subunit
9DDS 1.78 Å, Crystal structure of human AAGAB G domain with E144K mutation

Browse structure collections

About this viewer

MolViewer shows 7TWD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.