7U0F: HIV-1 Rev

HIV-1 Rev in complex with tubulin. Determined by electron microscopy at 3.53 Å resolution. Released 23 Aug 2023.

Method: Electron microscopy
Resolution: 3.53 Å
Organisms: Sus scrofa, Human immunodeficiency virus 1
Chains: 10
Atoms: 16,569
Mol. weight: 278.39 kDa
Released: 23 Aug 2023

Explore 7U0F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7U0F contains 87 α-helices and 61 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	1
α-helix	11-27	17
β-strand	55	1	2
β-strand	61	1	2
β-strand	65-68	4	1
β-strand	69	1	3
α-helix	73-79	7
β-strand	94	1	3
α-helix	104	1
α-helix	105-109	5
α-helix	111-113	3
α-helix	115-126	12
β-strand	137-140	4	1
α-helix	147-160	14
β-strand	168-172	5	1
α-helix	183-193	11
β-strand	201-205	5	1
α-helix	206-214	9
α-helix	224-243	20
α-helix	252-259	8
β-strand	268-271	4	4
α-helix	290-293	4
α-helix	298-300	3
β-strand	312	1	5
β-strand	315	1	4
β-strand	318	1	6
β-strand	319	1	7
α-helix	328-331	4
α-helix	332-336	5
β-strand	343	1	5
β-strand	355	1	7
α-helix	359-363	5
β-strand	376	1	6
β-strand	377-380	4	4
α-helix	382-384	3
α-helix	385-399	15
α-helix	406-408	3
α-helix	415-431	17
α-helix	432-436	5

Chain B: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	8
β-strand	6-8	3	9
α-helix	13-24	12
α-helix	44-48	5
β-strand	52-53	2	10
β-strand	59-60	2	10
β-strand	63-65	3	9
α-helix	70-76	7
β-strand	90	1	9
α-helix	101-105	5
α-helix	109-111	3
α-helix	113-124	12
β-strand	132-137	6	8
α-helix	143-158	16
β-strand	163-168	6	8
β-strand	169	1	11
α-helix	170-171	2
α-helix	181-186	6
α-helix	189-192	4
β-strand	198-200	3	8
β-strand	202	1	11
α-helix	205-212	8
α-helix	222-241	20
α-helix	250-257	8
β-strand	265-266	2	8
β-strand	269-270	2	12
α-helix	287-290	4
β-strand	315-316	2	13
α-helix	324-335	12
β-strand	351-352	2	13
β-strand	366-367	2	12
α-helix	373-389	17
α-helix	395-397	3
α-helix	406-426	21

Chain C: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	5-8	4	14
α-helix	10-27	18
β-strand	66-67	2	14
α-helix	72-79	8
α-helix	103-108	6
α-helix	115-124	10
β-strand	135-138	4	14
α-helix	147-159	13
β-strand	168	1	14
β-strand	171-172	2	15
α-helix	183-190	8
α-helix	191-195	5
β-strand	201	1	14
β-strand	204-205	2	15
α-helix	207-211	5
α-helix	212-216	5
α-helix	224-243	20
α-helix	252-259	8
β-strand	269	1	16
α-helix	290-293	4
β-strand	312	1	17
β-strand	318	1	18
α-helix	327-335	9
β-strand	343	1	17
α-helix	361-364	4
β-strand	376	1	18
β-strand	379	1	16
β-strand	381	1	17
α-helix	382-384	3
α-helix	385-401	17
α-helix	415-430	16

Chain D: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	19
α-helix	14-25	12
α-helix	44-48	5
β-strand	52-55	4	20
β-strand	58-60	3	20
β-strand	64-65	2	19
α-helix	71-76	6
α-helix	101-106	6
α-helix	109-113	5
α-helix	114-123	10
β-strand	130-135	6	19
α-helix	143-158	16
β-strand	168-170	3	21
α-helix	182-193	12
β-strand	199	1	22
β-strand	201-203	3	21
α-helix	205-213	9
α-helix	222-241	20
α-helix	250-257	8
β-strand	265	1	22
β-strand	269	1	23
α-helix	286-290	5
β-strand	313-314	2	24
α-helix	324-336	13
β-strand	367	1	23
β-strand	368-369	2	24
α-helix	375-387	13
α-helix	405-425	21

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	15-24	10
α-helix	26-28	3
α-helix	37-61	25

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	17-24	8
α-helix	41-59	19

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
α-helix	35-61	27

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-24	12
α-helix	27-29	3
α-helix	37-61	25

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-1A chain	A, C	protein	451	Sus scrofa	P02550 (AlphaFold model)
Tubulin beta chain	B, D	protein	445	Sus scrofa	P02554 (AlphaFold model)
Protein Rev	E, F, G, H, I, J	protein	116	Human immunodeficiency virus 1	P04616

Sequence of entity 1 (A, C), FASTA

>7U0F_1 Tubulin alpha-1A chain (chains A, C)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Sequence of entity 2 (B, D), FASTA

>7U0F_2 Tubulin beta chain (chains B, D)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEGEEDEA

Sequence of entity 3 (E, F, G, H, I, J), FASTA

>7U0F_3 Protein Rev (chains E, F, G, H, I, J)
MAGRSGDSDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
STYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGAKE

Primary citation

Structural basis of microtubule depolymerization by the kinesin-like activity of HIV-1 Rev. Eren, E., Watts, N.R., Randazzo, D. et al. Structure (2023) 31:1233. DOI 10.1016/j.str.2023.07.009 · PubMed

Other PDB entries of the same protein (UniProt P02550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7X4N 2.88 Å, Crystal Structure of C. elegans kinesin-4 KLP-12 complexed with tubulin and DARPin
9T1D 2.9 Å, Cryo-EM reconstruction of undecorated GDP microtubule
6MZG 3.21 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
8QAU 3.54 Å, Outer kinetochore Ndc80-Dam1 alpha/beta-tubulin complex
8X9P 3.54 Å, HURP (428-534)-alpha-tubulin-beta-tubulin complex
6MZE 3.6 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
6KIQ 3.62 Å, Complex of yeast cytoplasmic dynein MTBD-High and MT with DTT
1TUB 3.7 Å, Tubulin alpha-beta dimer, electron diffraction
9EDT 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
9EEB 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
9EDR 3.8 Å, Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin
9EDS 3.8 Å, Tubulin cofactors D,E,G,C bound to tubulin dimer -- TBCC N terminus unbound

Browse structure collections

About this viewer

MolViewer shows 7U0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.