7UGX: Asp-bound GltPh RSMR mutant in IFS-B1 state

Asp-bound GltPh RSMR mutant in IFS-B1 state. Determined by electron microscopy at 2.96 Å resolution. Released 29 Mar 2023.

Method: Electron microscopy
Resolution: 2.96 Å
Organism: Pyrococcus horikoshii
Chains: 1
Atoms: 3,108
Mol. weight: 44.34 kDa
Ligands: ASP
Released: 29 Mar 2023

Explore 7UGX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UGX contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	12-32	21
α-helix	36-42	7
α-helix	44-56	13
α-helix	58-72	15
α-helix	82-106	25
α-helix	117-119	3
α-helix	126-129	4
α-helix	130-135	6
α-helix	142-147	6
α-helix	151-169	19
α-helix	174-219	46
α-helix	223-241	19
α-helix	242-248	7
α-helix	249-254	6
α-helix	258-264	7
α-helix	266-275	10
α-helix	282-290	9
α-helix	296-307	12
α-helix	312-329	18
α-helix	335-351	17
α-helix	358-370	13
α-helix	377-388	12
α-helix	390-414	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate transporter homolog	A	protein	418	Pyrococcus horikoshii	O59010 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7UGX_1 Glutamate transporter homolog (chains A)
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMP
IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ
QFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA
ETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAHVMAHQGVHVVGELAKVTAAVYVGLT
LQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTSSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVATFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGA
IMLAMVLHSVGLPLTDPNVAAAYACILGIDAILDRGRTMVNVTGDLTGTAIVAKTEGT

Ligands and cofactors

ID	Name	Formula	Copies
ASP	Aspartic acid	C4 H7 N O4	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Environmentally Ultrasensitive Fluorine Probe to Resolve Protein Conformational Ensembles by 19 F NMR and Cryo-EM. Huang, Y., Reddy, K.D., Bracken, C. et al. J Am Chem Soc (2023) 145:8583-8592. DOI 10.1021/jacs.3c01003 · PubMed

Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RCP 2.2 Å, GltPh mutant (S279E/D405N) in complex with aspartate and sodium ions
7AHK 2.5 Å, Crystal structure of the outward-facing state of the substrate-free Na+-only bound…
7UG0 2.55 Å, TBOA-bound GltPh RSMR mutant in IFS state
9BH2 2.7 Å, Apo GltPh, outward-facing state
7UGJ 2.81 Å, TBOA-bound GltPh RSMR mutant in OFS state
7UGV 2.94 Å, Asp-bound GltPh RSMR mutant in IFS-A2 state
7UGD 2.95 Å, Asp-bound GltPh RSMR mutant in IFS-A1 state
2NWL 2.96 Å, Crystal structure of GltPh in complex with L-Asp
7UH3 2.99 Å, Asp-bound GltPh RSMR mutant in iOFS state
6X15 3.05 Å, Inward-facing state of the glutamate transporter homologue GltPh in complex with…
6UWF 3.08 Å, GltPh in complex with L-aspartate and sodium ions in outward-facing state
9BH1 3.1 Å, Apo GltPh, intermediate outward-facing state

Browse structure collections

About this viewer

MolViewer shows 7UGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.