7UHY: Human GATOR2 complex

Human GATOR2 complex. Determined by electron microscopy at 3.66 Å resolution. Released 20 Jul 2022.

Method: Electron microscopy
Resolution: 3.66 Å
Organism: Homo sapiens
Chains: 10
Atoms: 25,905
Mol. weight: 578.06 kDa
Ligands: ZN
Released: 20 Jul 2022

Explore 7UHY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UHY contains 129 α-helices and 238 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	17-21	5	1
β-strand	25-32	8	1
β-strand	42-44	3	1
β-strand	49-57	9	1
β-strand	63-68	6	2
β-strand	77-82	6	2
β-strand	87-91	5	2
α-helix	101-103	3
β-strand	107-108	2	2
β-strand	116-121	6	3
β-strand	128-133	6	3
β-strand	140-146	7	3
β-strand	179-183	5	3
β-strand	190-192	3	4
β-strand	199-203	5	4
β-strand	207-212	6	4
β-strand	219-223	5	4
β-strand	228-232	5	5
β-strand	239-244	6	5
β-strand	247-252	6	5
α-helix	253-255	3
β-strand	256	1	6
β-strand	258	1	6
β-strand	261-262	2	5
α-helix	263-266	4
α-helix	269	1
β-strand	270-275	6	7
β-strand	282-287	6	7
β-strand	293-297	5	7
β-strand	314-318	5	7
β-strand	327-330	4	8
β-strand	337-341	5	8
β-strand	347-351	5	8
β-strand	356-359	4	9
β-strand	366-370	5	9
β-strand	374-379	6	9
α-helix	390-399	10
α-helix	409-411	3
α-helix	412-415	4
α-helix	421-442	22
α-helix	451-454	4
α-helix	455-461	7
α-helix	488-497	10
α-helix	509-518	10
α-helix	521-530	10
α-helix	534-546	13
α-helix	553-561	9
α-helix	571-579	9
α-helix	580-582	3
α-helix	586-596	11
α-helix	598	1
α-helix	603-606	4
α-helix	613-623	11
α-helix	626-643	18
α-helix	646-648	3
α-helix	649-652	4
α-helix	656-669	14
α-helix	673-679	7
α-helix	685-688	4
α-helix	691-706	16
α-helix	710-723	14
α-helix	727-731	5
β-strand	733-736	4	10
β-strand	743	1	10
β-strand	774	1	11
α-helix	780	1
β-strand	781	1	11
α-helix	782-783	2
β-strand	784	1	12
β-strand	791	1	12
α-helix	820-822	3
β-strand	824-827	4	13
β-strand	832	1	14
β-strand	833-835	3	13
α-helix	836-845	10
α-helix	858-860	3

Chain B: 35 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	15
β-strand	17-21	5	15
β-strand	25-32	8	15
β-strand	42-44	3	15
β-strand	49-57	9	15
β-strand	63-68	6	16
β-strand	77-82	6	16
β-strand	87-91	5	16
α-helix	101-103	3
β-strand	107-108	2	16
β-strand	116-121	6	17
β-strand	128-133	6	17
β-strand	142-146	5	17
β-strand	179-181	3	17
β-strand	190-192	3	18
β-strand	199-203	5	18
β-strand	207-212	6	18
β-strand	215-223	9	18
β-strand	228-232	5	19
β-strand	239-244	6	19
β-strand	247-252	6	19
α-helix	253-255	3
β-strand	256	1	20
β-strand	258	1	20
β-strand	261-262	2	19
α-helix	263-266	4
α-helix	269	1
β-strand	270-275	6	21
β-strand	282-287	6	21
β-strand	293-297	5	21
β-strand	314-318	5	21
β-strand	327-330	4	22
β-strand	338-341	4	22
β-strand	347-350	4	22
β-strand	357-359	3	23
β-strand	366-369	4	23
β-strand	374-379	6	23
α-helix	390-399	10
α-helix	409-411	3
α-helix	412-415	4
α-helix	421-442	22
α-helix	450-454	5
α-helix	456-459	4
α-helix	460-462	3
α-helix	488-497	10
α-helix	509-518	10
α-helix	521-530	10
α-helix	534-546	13
α-helix	553-561	9
α-helix	571-579	9
α-helix	580-582	3
α-helix	586-596	11
α-helix	598	1
α-helix	603-606	4
α-helix	613-623	11
α-helix	626-643	18
α-helix	646-648	3
α-helix	649-652	4
α-helix	656-669	14
α-helix	673-679	7
α-helix	685-688	4
α-helix	691-705	15
α-helix	710-723	14
β-strand	733-737	5	24
β-strand	743-744	2	24
β-strand	774	1	25
β-strand	781	1	25
α-helix	782-783	2
β-strand	784	1	26
α-helix	785	1
β-strand	791	1	26
α-helix	818-822	5
β-strand	824-827	4	27
β-strand	832-835	4	27
α-helix	836-845	10
α-helix	858-862	5

Chain C: 17 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	21-24	4	28
β-strand	29-34	6	29
β-strand	40-45	6	29
β-strand	49-54	6	29
β-strand	59-64	6	29
β-strand	77-82	6	30
β-strand	89-94	6	30
β-strand	99-103	5	30
β-strand	112-116	5	30
β-strand	123-128	6	31
β-strand	135-140	6	31
β-strand	144-149	6	31
β-strand	157-160	4	31
β-strand	166-171	6	32
β-strand	178-183	6	32
β-strand	187-192	6	32
β-strand	201-204	4	32
β-strand	210-215	6	33
β-strand	222-227	6	33
β-strand	231-236	6	33
β-strand	243-249	7	33
β-strand	254-259	6	34
α-helix	260	1
β-strand	266-271	6	34
β-strand	278-282	5	34
β-strand	291-293	3	34
β-strand	300-307	8	28
β-strand	310-318	9	28
β-strand	322-327	6	28
α-helix	328-330	3
β-strand	332	1	34
α-helix	334-337	4
β-strand	341-345	5	35
β-strand	351-356	6	35
α-helix	357-360	4
β-strand	395-401	7	35
α-helix	410-418	9
α-helix	426-440	15
α-helix	443-456	14
α-helix	634-645	12
α-helix	650-660	11
α-helix	662-665	4
α-helix	670-686	17
α-helix	690-698	9
α-helix	703-707	5
α-helix	708-710	3
β-strand	714	1	14
β-strand	716-719	4	10
α-helix	724	1
β-strand	725	1	10
α-helix	726-727	2
β-strand	732	1	36
β-strand	739	1	36
β-strand	742	1	37
β-strand	749	1	37
β-strand	753-756	4	13
β-strand	763-764	2	13
α-helix	766-775	10

Chain D: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	529-531	3
β-strand	535	1	38
α-helix	536-538	3
β-strand	541-545	5	39
β-strand	549-553	5	39
β-strand	646-651	6	39
α-helix	660-665	6
α-helix	674-687	14
α-helix	690-702	13
α-helix	705-707	3
α-helix	708-710	3
α-helix	719-721	3
α-helix	726-739	14
α-helix	742-754	13
α-helix	836-847	12
α-helix	853-855	3
α-helix	856-873	18
α-helix	877-883	7
α-helix	891-893	3
β-strand	896-901	6	24
β-strand	908-909	2	24
β-strand	913	1	40
β-strand	920	1	40
β-strand	923	1	41
β-strand	930	1	41
β-strand	934-937	4	27
β-strand	944-946	3	27
α-helix	947-956	10
α-helix	968-972	5

Chain E: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	9
β-strand	15-20	6	42
β-strand	26-31	6	42
β-strand	35-41	7	42
β-strand	47-54	8	42
β-strand	60-65	6	43
α-helix	68-70	3
β-strand	73-78	6	43
β-strand	83-90	8	43
β-strand	101-109	9	43
β-strand	116-121	6	44
α-helix	122-123	2
α-helix	124-126	3
β-strand	129-134	6	44
β-strand	138-143	6	44
β-strand	154-160	7	44
β-strand	165-170	6	45
β-strand	181-186	6	45
β-strand	197-203	7	45
β-strand	208-215	8	45
β-strand	224-227	4	46
α-helix	228-229	2
β-strand	236-241	6	46
β-strand	245-252	8	46
α-helix	253-256	4
α-helix	264-265	2
β-strand	266-274	9	46
β-strand	281-286	6	47
β-strand	292-297	6	47
β-strand	301-306	6	47
β-strand	314-320	7	47
β-strand	325	1	47

Chain F: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	23
β-strand	15-20	6	48
β-strand	26-31	6	48
β-strand	35-41	7	48
β-strand	47-54	8	48
β-strand	60-65	6	49
α-helix	68-70	3
β-strand	73-78	6	49
β-strand	83-90	8	49
β-strand	101-109	9	49
β-strand	116-121	6	50
α-helix	122-123	2
α-helix	124-126	3
β-strand	129-134	6	50
β-strand	138-143	6	50
β-strand	154-160	7	50
β-strand	165-170	6	51
β-strand	181-186	6	51
β-strand	197-203	7	51
β-strand	208-215	8	51
β-strand	224-227	4	52
α-helix	228-229	2
β-strand	236-241	6	52
β-strand	245-252	8	52
α-helix	253-256	4
α-helix	264-265	2
β-strand	266-274	9	52
β-strand	281-286	6	53
β-strand	292-297	6	53
β-strand	301-306	6	53
β-strand	314-320	7	53

Chain G: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	35
β-strand	15-20	6	54
β-strand	26-31	6	54
β-strand	35-41	7	54
β-strand	47-54	8	54
β-strand	60-65	6	55
α-helix	68-70	3
β-strand	73-78	6	55
β-strand	83-89	7	55
β-strand	102-109	8	55
β-strand	116-121	6	56
α-helix	122-123	2
α-helix	124-126	3
β-strand	129-134	6	56
β-strand	138-143	6	56
β-strand	154-160	7	56
β-strand	165-170	6	57
β-strand	181-186	6	57
β-strand	197-203	7	57
β-strand	208-215	8	57
β-strand	224-227	4	58
α-helix	228-229	2
β-strand	236-241	6	58
β-strand	245-252	8	58
α-helix	253-256	4
α-helix	263-265	3
β-strand	266-274	9	58
β-strand	281-286	6	59
β-strand	293-297	5	59
β-strand	301-307	7	59
β-strand	313-320	8	59

Chain H: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	39
β-strand	16-21	6	60
β-strand	27-32	6	60
β-strand	36-41	6	60
α-helix	43-45	3
β-strand	48-53	6	60
β-strand	60-65	6	61
α-helix	66-67	2
α-helix	68-70	3
β-strand	73-78	6	61
β-strand	82-89	8	61
β-strand	92-99	8	61
β-strand	106-111	6	62
α-helix	112-113	2
α-helix	114-116	3
β-strand	119-124	6	62
β-strand	129-136	8	62
β-strand	139-145	7	62
β-strand	153-158	6	63
β-strand	181-186	6	63
β-strand	191-196	6	63
β-strand	202-208	7	63
β-strand	215-220	6	64
α-helix	221-222	2
β-strand	229-235	7	64
β-strand	239-245	7	64
β-strand	254-260	7	64
β-strand	265-270	6	65
β-strand	276-281	6	65
β-strand	286-291	6	65
β-strand	297-299	3	65

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GATOR complex protein MIOS	A, B	protein	894	Homo sapiens	Q9NXC5 (AlphaFold model)
GATOR complex protein WDR24	C	protein	790	Homo sapiens	Q96S15 (AlphaFold model)
GATOR complex protein WDR59	D	protein	974	Homo sapiens	Q6PJI9 (AlphaFold model)
Isoform B of Nucleoporin SEH1	E, F, G	protein	421	Homo sapiens	Q96EE3 (AlphaFold model)
Protein SEC13 homolog	H	protein	322	Homo sapiens	P55735
Unknown	I	protein	15	Homo sapiens
Unknown	J	protein	8	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>7UHY_1 GATOR complex protein MIOS (chains A, B)
MEMDYKDDDDKGGGGGASTMSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAG
SLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFK
DLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKV
KLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMF
VNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTG
LLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVV
TPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSR
YGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVK
SSLGMVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEW
ERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRL
QLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMK
EAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYR
NLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQY
GVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFN
NWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP

Sequence of entity 2 (C), FASTA

>7UHY_2 GATOR complex protein WDR24 (chains C)
MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFV
EKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHK
RTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFA
STFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTH
RAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVT
TGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLV
AAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYA
LAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLP
LMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLL
GDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGS
EADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVL
GERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCS
HCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCP
AGCGHLCEYS

Sequence of entity 3 (D), FASTA

>7UHY_3 GATOR complex protein WDR59 (chains D)
MAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKW
DIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDL
LVTSSVDTYIYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKP
STAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKA
RYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKDY
QLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLHTEDTDHQHTA
SHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSV
HCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCL
EPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTS
GARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLY
SGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIACLLPVHK
SLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSDPDLETPWA
RHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHS
RYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERE
RDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGV
YCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVC
PTGCGCHCLLESTF

Sequence of entity 4 (E, F, G), FASTA

>7UHY_4 Isoform B of Nucleoporin SEH1 (chains E, F, G)
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRYFF
TPLDSPRAGSRWSSYAQLLPPPPPPLVEHSCDADTANLQYPHPRRRYLSRPLNPLPENEG
I

Sequence of entity 5 (H), FASTA

>7UHY_5 Protein SEC13 homolog (chains H)
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPV
WQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLIL
ACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIK
RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
FIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCI
SDVNKGQGSVSASVTEGQQNEQ

Sequence of entity 6 (I), FASTA

>7UHY_6 Unknown (chains I)
XXXXXXXXXXXXXXX

Sequence of entity 7 (J), FASTA

>7UHY_7 Unknown (chains J)
XXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	16

Primary citation

Structure of the nutrient-sensing hub GATOR2. Valenstein, M.L., Rogala, K.B., Lalgudi, P.V. et al. Nature (2022) 607:610-616. DOI 10.1038/s41586-022-04939-z · PubMed

Other PDB entries of the same protein (UniProt Q9NXC5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DX1 3.36 Å, Human GATOR2 complex - Sestrin2 bound state
9DX2 3.4 Å, Human GATOR2 complex - CASTOR1 bound state
9LWF 3.41 Å, Cryo-EM structure of dual sensor bound GATOR2 complex
9DX0 3.47 Å, Human GATOR2 complex - apo state
9OTI 3.5 Å, GATOR2 complex bound to arginine sensor CASTOR1
9LVK 3.59 Å, Cryo-EM structure of CASTOR1 bound human GATOR2 complex
9LVJ 3.82 Å, Cryo-EM structure of Sestrin2 bound human GATOR2 complex

Browse structure collections

About this viewer

MolViewer shows 7UHY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.