7UJL: Recombination protein bet

Bacteriophage Lambda Red-Beta N-terminal domain helical assembly in complex with dsDNA. Determined by electron microscopy at 3.3 Å resolution. Released 5 Oct 2022.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Escherichia virus Lambda, Escherichia coli
Chains: 3
Atoms: 1,447
Mol. weight: 37.87 kDa
Released: 5 Oct 2022

Explore 7UJL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UJL contains 10 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	23-34	12
α-helix	41-54	14
β-strand	63-67	5	1
α-helix	68	1
α-helix	69-71	3
β-strand	73-77	5	1
α-helix	79-87	9
β-strand	92-99	8	2
β-strand	103-110	8	2
β-strand	117-122	6	2
α-helix	123-126	4
α-helix	129-131	3
α-helix	142-145	4
α-helix	147-163	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Recombination protein bet	A	protein	185	Escherichia virus Lambda	P03698
Template DNA	B	DNA	27	Escherichia coli
Complementary DNA	C	DNA	27	Escherichia coli

Sequence of entity 1 (A), FASTA

>7UJL_1 Recombination protein bet (chains A)
MSTALATLAGKLAERVGMDSVDPQELITTLRQTAFKGDASDAQFIALLIVANQYGLNPWT
KEIYAFPDKQNGIVPVVGVDGWSRIINENQQFDGMDFEQDNESCTCRIYRKDRNHPICVT
EWMDECRREPFKTREGREITGPWQSHPKRMLRHKAMIQCARLAFGFAGIYDKDEAERSSH
HHHHH

Sequence of entity 2 (B), FASTA

>7UJL_2 Template DNA (chains B)
TGCAGCAGCTTTACCATCTGCCGCTGG

Sequence of entity 3 (C), FASTA

>7UJL_3 Complementary DNA (chains C)
CCAGCGGCAGATGGTAAAGCTGCTGCA

Primary citation

Red beta 177 annealase structure reveals details of oligomerization and lambda Red-mediated homologous DNA recombination. Newing, T.P., Brewster, J.L., Fitschen, L.J. et al. Nat Commun (2022) 13:5649. DOI 10.1038/s41467-022-33090-6 · PubMed

Other PDB entries of the same protein (UniProt P03698), best resolution first:

8TFU 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 1
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
6M9K 2.3 Å, Crystal structure of lambda exonuclease in complex with the Red beta C-terminal domain

Browse structure collections

About this viewer

MolViewer shows 7UJL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.