8TGC: Red beta C-terminal domain

Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4. Determined by X-ray diffraction at 1.48 Å resolution. Released 13 Mar 2024.

Method: X-ray diffraction
Resolution: 1.48 Å
Organisms: Escherichia phage Lambda, Escherichia coli
Chains: 4
Atoms: 1,466
Mol. weight: 21.46 kDa
Released: 13 Mar 2024

Explore 8TGC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TGC contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	195	1
β-strand	196	1	2
α-helix	197-198	2
α-helix	199-211	13
α-helix	216-220	5
α-helix	221-228	8
α-helix	235-237	3
β-strand	239	1	2
α-helix	240-256	17

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	195	1
β-strand	196	1	1
α-helix	197-198	2
α-helix	199-212	14
α-helix	216-220	5
α-helix	221-228	8
α-helix	235-237	3
β-strand	239	1	1
α-helix	240-256	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Recombination protein bet	A, B	protein	84	Escherichia phage Lambda	P03698
Plasmid-derived single-stranded DNA-binding protein	C, D	protein	10	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8TGC_1 Recombination protein bet (chains A, B)
GSHMTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSE
LTQAEAVKALGFLKQKAAEQKVAA

Sequence of entity 2 (C, D), FASTA

>8TGC_2 Plasmid-derived single-stranded DNA-binding protein (chains C, D)
WMDFDDDIPF

Primary citation

Structural Basis for the Interaction of Red beta Single-Strand Annealing Protein with Escherichia coli Single-Stranded DNA-Binding Protein. Zakharova, K., Liu, M., Greenwald, J.R. et al. J Mol Biol (2024) 436:168590-168590. DOI 10.1016/j.jmb.2024.168590 · PubMed

Other PDB entries of the same protein (UniProt P03698), best resolution first:

8TFU 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 1
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
6M9K 2.3 Å, Crystal structure of lambda exonuclease in complex with the Red beta C-terminal domain
7UJL 3.3 Å, Bacteriophage Lambda Red-Beta N-terminal domain helical assembly in complex with dsDNA

Browse structure collections

About this viewer

MolViewer shows 8TGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.