7UL2: Inactive NTSR1

CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6. Determined by electron microscopy at 2.4 Å resolution. Released 29 Jun 2022.

Method: Electron microscopy
Resolution: 2.4 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 2,624
Mol. weight: 62.42 kDa
Ligands: Q6Q
Released: 29 Jun 2022

Explore 7UL2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UL2 contains 16 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	2
β-strand	26-27	2	2
β-strand	32-38	7	3
β-strand	51-53	3	3
β-strand	59-60	2	3
β-strand	74	1	4
β-strand	79	1	4
β-strand	97-102	6	3
α-helix	108-109	2
β-strand	110-113	4	3

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	61-89	29
α-helix	100-114	15
α-helix	115-119	5
α-helix	120-123	4
α-helix	124-129	6
α-helix	137-171	35
α-helix	173-179	7
α-helix	182-199	18
α-helix	201-206	6
β-strand	207-212	6	1
β-strand	221-226	6	1
α-helix	230-241	12
α-helix	242-246	5
α-helix	247-263	17
α-helix	273-328	37
α-helix	336-367	32
α-helix	369-378	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor 1	R	protein	419	Homo sapiens	P30989 (AlphaFold model), P41145 (AlphaFold model)
Nanobody 6	D	protein	133	Lama glama

Sequence of entity 1 (R), FASTA

>7UL2_1 Neurotensin receptor 1 (chains R)
DYKDDDDAMGQPGNGSAFLLAPNRSHAPDHDVENLYFQGQRAQAGLEEALLAPGFGNASG
NASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTLFTLARKKSLQSLQST
VHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVA
SLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAG
GLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLYTLMILRLKSVRLLSGSREKDRNLR
RITRLVLAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTI
NPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY

Sequence of entity 2 (D), FASTA

>7UL2_2 Nanobody 6 (chains D)
MAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTK
YGDSVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVT
VSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
Q6Q	2-[[1-(7-chloranylquinolin-4-yl)-5-(2,6-dimethoxyphenyl)pyrazol-3-yl]carbonylam…	C32 H31 Cl N4 O5	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Structure determination of inactive-state GPCRs with a universal nanobody. Robertson, M.J., Papasergi-Scott, M.M., He, F. et al. Nat Struct Mol Biol (2022) 29:1188-1195. DOI 10.1038/s41594-022-00859-8 · PubMed

Other PDB entries of the same protein (UniProt P30989 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9P7Z 2.1 Å, NTSR1-Gi-NTS(8-13) Complex in the Canonical, AHD Open State (C-Open-Apo)
9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
9VAW 2.24 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gq (delipidated) complex in…
9P80 2.3 Å, NTSR1-Gi-NTS(8-13) Complex in the Non-Canonical, AHD Open State (NC-Open-Apo)
20ZG 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
20ZH 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
9P82 2.4 Å, NTSR1-Gi-NTS(8-13) GTP-Bound Complex in the Canonical, AHD Closed State (C-Closed-GTP)
20ZC 2.6 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gi1 (delipidated) complex in…
9P81 2.6 Å, NTSR1-Gi-NTS(8-13), GTP-bound Complex in the Canonical, AHD Open State (C-Open-GTP)
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…

Browse structure collections

About this viewer

MolViewer shows 7UL2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.