9VAW: Neurotensin receptor type 1

Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gq (delipidated) complex in nucleotide-free C state. Determined by electron microscopy at 2.24 Å resolution. Released 3 Jun 2026.

Method: Electron microscopy
Resolution: 2.24 Å
Organisms: Homo sapiens, synthetic construct, Mus musculus
Chains: 6
Atoms: 9,335
Mol. weight: 165.72 kDa
Released: 3 Jun 2026

Explore 9VAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VAW contains 39 α-helices and 61 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	13-36	24
β-strand	39-45	7	2
α-helix	52-62	11
β-strand	190-195	6	2
β-strand	200-205	6	2
α-helix	213-215	3
α-helix	217-220	4
β-strand	225-231	7	2
α-helix	232-234	3
α-helix	247-260	14
α-helix	262-264	3
β-strand	268-274	7	2
α-helix	276-282	7
α-helix	302-315	14
β-strand	324-328	5	2
α-helix	336-355	20

Chain B: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	4-25	22
α-helix	30-33	4
α-helix	38-39	2
β-strand	43	1	3
β-strand	47-51	5	4
β-strand	58-63	6	5
β-strand	69-74	6	5
β-strand	78-83	6	5
β-strand	89-94	6	5
β-strand	100-105	6	6
β-strand	111-116	6	6
β-strand	121-125	5	6
β-strand	134-139	6	6
β-strand	146-153	8	7
β-strand	156-161	6	7
β-strand	166-170	5	7
β-strand	175-180	6	7
β-strand	187-192	6	8
β-strand	198-203	6	8
β-strand	208-212	5	8
β-strand	218-222	5	8
β-strand	229-234	6	9
β-strand	240-245	6	9
β-strand	250-254	5	9
β-strand	259-264	6	9
α-helix	272	1
β-strand	273-278	6	3
β-strand	284-289	6	3
β-strand	294-298	5	3
β-strand	304-308	5	3
β-strand	315-320	6	4
β-strand	327-331	5	4
β-strand	336-339	4	4

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	7-23	17
α-helix	30-44	15
α-helix	45-47	3

Chain D: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	10
β-strand	10-12	3	11
β-strand	17-25	9	10
α-helix	29-31	3
β-strand	33-39	7	11
β-strand	45-51	7	11
β-strand	58-60	3	11
α-helix	62-64	3
β-strand	68-73	6	10
α-helix	74-76	3
β-strand	78-84	7	10
α-helix	88-90	3
β-strand	92-99	8	11
β-strand	110-111	2	11
β-strand	115-119	5	11
β-strand	128-129	2	12
β-strand	134-136	3	13
β-strand	143-149	7	12
β-strand	154	1	14
β-strand	160	1	14
β-strand	162-167	6	13
β-strand	174-178	5	13
β-strand	182-183	2	13
α-helix	184	1
β-strand	191-195	5	12
β-strand	199-204	6	12
α-helix	209-211	3
β-strand	213-219	7	13
α-helix	225	1
β-strand	226-227	2	13
β-strand	231-234	4	13

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	60-89	30
α-helix	101-122	22
α-helix	123-129	7
α-helix	138-171	34
α-helix	173-179	7
α-helix	182-200	19
α-helix	202-206	5
β-strand	207-211	5	1
α-helix	219-221	3
β-strand	222-226	5	1
α-helix	230-241	12
α-helix	242-246	5
α-helix	247-272	26
α-helix	289-291	3
α-helix	294-328	35
α-helix	336-364	29
α-helix	369-380	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1	R	protein	436	Homo sapiens	P30989 (AlphaFold model)
JMV449	L	protein	6	synthetic construct
Guanine nucleotide-binding protein G(q) subunit alpha	A	protein	353	Homo sapiens	P50148 (AlphaFold model)
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	B	protein	358	Homo sapiens	P62873 (AlphaFold model)
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2	C	protein	71	Homo sapiens	P59768 (AlphaFold model)
scFv16	D	protein	259	Mus musculus

Sequence of entity 1 (R), FASTA

>9VAW_1 Neurotensin receptor type 1 (chains R)
MGQPGNGSAFLLAPNRSHAPDHDVENLYFQGQRAQAGLEEALLAPGFGNASGNASERVLA
APSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTLFTLARKKSLQSLQSTVHYHLGSL
ALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYL
AICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTI
HTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSM
AIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMV
TNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTL
SSNATRETLYLEVLFQ

Sequence of entity 2 (L), FASTA

>9VAW_2 JMV449 (chains L)
KKPYIL

Sequence of entity 3 (A), FASTA

>9VAW_3 Guanine nucleotide-binding protein G(q) subunit alpha (chains A)
MGSTLSAEDKAAVERSKMIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
YSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFEN
PYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPT
TGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNEN
RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAR
EFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV

Sequence of entity 4 (B), FASTA

>9VAW_4 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (chains B)
MHHHHHHLEVLFQGPGSSGSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGR
IQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMT
CAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVISSG
DTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTF
TGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSG
RLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Sequence of entity 5 (C), FASTA

>9VAW_5 Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (chains C)
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFSAIL

Sequence of entity 6 (D), FASTA

>9VAW_6 scFv16 (chains D)
DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYY
ADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVS
SGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQR
PGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFG
AGTKLELKAAAHHHHHHHH

Primary citation

The dynamic basis of G-protein recognition and activation by a GPCR. Kobayashi, K., Kawakami, K., Matsui, T.E. et al. Nature (2026) 652:812-821. DOI 10.1038/s41586-026-10228-w · PubMed

Other PDB entries of the same protein (UniProt P30989 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9P7Z 2.1 Å, NTSR1-Gi-NTS(8-13) Complex in the Canonical, AHD Open State (C-Open-Apo)
9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
9P80 2.3 Å, NTSR1-Gi-NTS(8-13) Complex in the Non-Canonical, AHD Open State (NC-Open-Apo)
20ZG 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
20ZH 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
7UL2 2.4 Å, CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6
9P82 2.4 Å, NTSR1-Gi-NTS(8-13) GTP-Bound Complex in the Canonical, AHD Closed State (C-Closed-GTP)
20ZC 2.6 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gi1 (delipidated) complex in…
9P81 2.6 Å, NTSR1-Gi-NTS(8-13), GTP-bound Complex in the Canonical, AHD Open State (C-Open-GTP)
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…

Browse structure collections

About this viewer

MolViewer shows 9VAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.