7UNM: Human TMEM175 in an closed state

Human TMEM175 in an closed state. Determined by electron microscopy at 2.61 Å resolution. Released 29 Jun 2022.

Method: Electron microscopy
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,774
Mol. weight: 111.53 kDa
Released: 29 Jun 2022

Explore 7UNM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UNM contains 44 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 22 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	31	1	4
α-helix	34-50	17
α-helix	52-56	5
α-helix	62-64	3
α-helix	68-102	35
β-strand	105	1	4
α-helix	107-121	15
α-helix	123-132	10
α-helix	137-163	27
α-helix	165-167	3
α-helix	170-173	4
β-strand	256	1	5
α-helix	258-283	26
α-helix	288-294	7
α-helix	300-302	3
α-helix	303-332	30
β-strand	334	1	6
β-strand	337	1	5
α-helix	339-352	14
α-helix	355-359	5
α-helix	372-399	28
α-helix	401-404	4
β-strand	405	1	6
α-helix	407-409	3
α-helix	416-439	24
α-helix	441-443	3
α-helix	444-460	17
α-helix	462-475	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endosomal/lysosomal potassium channel TMEM175	A, B	protein	504	Homo sapiens	Q9BSA9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7UNM_1 Endosomal/lysosomal potassium channel TMEM175 (chains A, B)
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI
SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI
TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL
YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP
SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ
QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA
RPEHPPPAPTGQDDPQSQLLPAPC

Primary citation

Differential ion dehydration energetics explains selectivity in the non-canonical lysosomal K + channel TMEM175. Oh, S., Marinelli, F., Zhou, W. et al. Elife (2022) 11. DOI 10.7554/eLife.75122 · PubMed

Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UNL 2.45 Å, Human TMEM175 in an open state
6WC9 2.64 Å, Human open state TMEM175 in KCl
8DHM 2.73 Å, Human TMEM175 in complex with 4-aminopyridine
9VSQ 2.74 Å, The TUG-891-bound structure of TMEM175
9VSR 2.92 Å, The DCY1040 and TUG-891-bound structure of TMEM175
6WCA 3.03 Å, Human closed state TMEM175 in KCl
6WCB 3.17 Å, Human open state TMEM175 in CsCl
6W8N 3.2 Å, Structure of a trans-membrane protein
6WCC 3.24 Å, Human closed state TMEM175 in CsCl
6W8O 3.4 Å, Structure of an Apo membrane protein
8FYF 3.4 Å, Human TMEM175-LAMP1 transmembrane domain only complex
9VSP 3.4 Å, The DCY1020-bound structure of TMEM175

Browse structure collections

About this viewer

MolViewer shows 7UNM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.