7UVJ: Apolipoprotein E

Rationally Designed ED1 Epitope-Scaffold Immunogen for SARS-CoV-2. Determined by X-ray diffraction at 1.99 Å resolution. Released 12 Oct 2022.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,670
Mol. weight: 34.37 kDa
Released: 12 Oct 2022

Explore 7UVJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UVJ contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	26-42	17
α-helix	46-53	8
α-helix	56-79	24
α-helix	84-85	2
α-helix	91-122	32
α-helix	131-165	35

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	26-41	16
α-helix	46-53	8
α-helix	56-79	24
α-helix	91-124	34
α-helix	132-165	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein E	A, B	protein	147	Escherichia coli	P02649 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7UVJ_1 Apolipoprotein E (chains A, B)
GHMSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSEL
EEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTKELRNRLA
SHLGKLQDRLLRDADDLQKRLAVYQAG

Primary citation

Adaptation-proof SARS-CoV-2 vaccine design. Vishweshwaraiah, Y.L., Hnath, B., Rackley, B. et al. Adv Funct Mater (2022) 32. DOI 10.1002/adfm.202206055 · PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)

Browse structure collections

About this viewer

MolViewer shows 7UVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.