7V1L: SNASP core

Structure of sNASP core in complex with H3 alpha3 helix peptide. Determined by X-ray diffraction at 2.85 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,852
Mol. weight: 30.65 kDa
Released: 20 Apr 2022

Explore 7V1L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V1L contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	40-56	17
α-helix	59-77	19
α-helix	82-84	3
α-helix	85-98	14
α-helix	176-191	16
α-helix	196-215	20
α-helix	219-236	18
α-helix	242-257	16
α-helix	261-304	44
α-helix	307-323	17
α-helix	327-330	4

Chain V: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	122-130	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Nuclear autoantigenic sperm protein	B	protein	252	Homo sapiens	P49321 (AlphaFold model)
H3 alpha3 helix peptide	V	protein	20	Homo sapiens	P84243 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7V1L_1 Isoform 2 of Nuclear autoantigenic sperm protein (chains B)
SADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFF
FYGKSLLELARLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLK
LGEVSVESENYVQAVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQF
SKSIEVIENRMAVLNEQVKEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAE
LALKATLVESST

Sequence of entity 2 (V), FASTA

>7V1L_2 H3 alpha3 helix peptide (chains V)
RVTIMPKDIQLARRIRGERA

Primary citation

NASP maintains histone H3-H4 homeostasis through two distinct H3 binding modes. Bao, H., Carraro, M., Flury, V. et al. Nucleic Acids Res (2022) 50:5349-5368. DOI 10.1093/nar/gkac303 · PubMed

Other PDB entries of the same protein (UniProt P49321 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V1M 2.83 Å, Structural basis for the co-chaperone relationship of sNASP and ASF1b
7V6P 2.9 Å, Crystal structure of human sNASP TPR domain
7V6Q 3.0 Å, Crystal structure of sNASP-ASF1A-H3.1-H4 complex
7V1K 3.29 Å, Apo structure of sNASP core

Browse structure collections

About this viewer

MolViewer shows 7V1L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.