7V9B: 14-3-3 epsilon with FOXO3a peptide

Crystal Structure of 14-3-3 epsilon with FOXO3a peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 31 Aug 2022.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,148
Mol. weight: 30.46 kDa
Ligands: 323
Released: 31 Aug 2022

Explore 7V9B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V9B contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	3-17	15
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-73	35
α-helix	76-103	28
α-helix	104-108	5
α-helix	109-111	3
α-helix	115-134	20
α-helix	138-162	25
α-helix	168-179	12
α-helix	180-184	5
α-helix	188-204	17
α-helix	206-208	3
α-helix	214-231	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
YWHAE/FAM22B fusion protein	A	protein	249	Homo sapiens	P62258 (AlphaFold model)
Arg-arg-arg-ala-val-sep-met-asp-asn-ser-asn	B	protein	11	Homo sapiens	O43524 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7V9B_1 YWHAE/FAM22B fusion protein (chains A)
GSHMASMTGGQQMGRGSMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERN
LLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDV
LDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL
PPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQL
LRDNLTLWT

Sequence of entity 2 (B), FASTA

>7V9B_2 ARG-ARG-ARG-ALA-VAL-SEP-MET-ASP-ASN-SER-ASN (chains B)
RRRAVSMDNSN

Ligands and cofactors

ID	Name	Formula	Copies
323	2-[3,6-bis(dimethylamino)xanthen-9-yl]-5-methanoyl-benzoate	C25 H22 N2 O4	1

Water and common crystallization additives (IMD, MPD, GOL) are not listed.

Primary citation

Structure of a 14-3-3 epsilon :FOXO3a pS253 Phosphopeptide Complex Reveals 14-3-3 Isoform-Specific Binding of Forkhead Box Class O Transcription Factor (FOXO) Phosphoproteins. Mathivanan, S., Chunchagatta Lakshman, P.K., Singh, M. et al. ACS Omega (2022) 7:24344-24352. DOI 10.1021/acsomega.2c01700 · PubMed

Other PDB entries of the same protein (UniProt P62258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BR9 1.75 Å, 14-3-3 Protein Epsilon (Human) Complexed to Peptide
3UAL 1.8 Å, Crystal Structure of 14-3-3 epsilon with Mlf1 peptide
3UBW 1.9 Å, Complex of 14-3-3 isoform epsilon, a Mlf1 phosphopeptide and a small fragment hit from a…
29II 2.17 Å, Structure of 14-3-3 epsilon in complex with a peptide derived from AMPK gamma 2
6EIH 2.7 Å, The crystal structure of 14-3-3 epsilon in complex with the phosphorylated NELFE peptide
8DGP 2.7 Å, 14-3-3 epsilon bound to phosphorylated PEAK3 (pS69) peptide
8DP5 3.1 Å, Structure of the PEAK3/14-3-3 complex
7C8E 3.16 Å, Crystal Structure of 14-3-3 epsilon with 9J10 peptide
8DGN 3.16 Å, 14-3-3 epsilon bound to phosphorylated PEAK2 (pS826) peptide
8DGM 3.2 Å, 14-3-3 epsilon bound to phosphorylated PEAK1 (pT1165) peptide
8Q1S 3.23 Å, Pathogenic mutations of human phosphorylation sites affect protein-protein interactions

Browse structure collections

About this viewer

MolViewer shows 7V9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.