7VGG: Ultraviolet-B activated UVR8

Cryo-EM structure of Ultraviolet-B activated UVR8 in complex with COP1. Determined by electron microscopy at 3.1 Å resolution. Released 4 May 2022.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 5,274
Mol. weight: 129.96 kDa
Released: 4 May 2022

Explore 7VGG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VGG contains 11 α-helices and 58 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 29 β-strands

Element	Residues	Length	Sheet
β-strand	355-362	8	1
β-strand	374-379	6	2
β-strand	385-390	6	2
β-strand	394-399	6	2
α-helix	400-405	6
β-strand	415-418	4	2
β-strand	423-428	6	3
β-strand	435-440	6	3
β-strand	445-449	5	3
β-strand	454-459	6	3
β-strand	466-471	6	4
β-strand	478-483	6	4
β-strand	487-492	6	4
β-strand	498-503	6	4
β-strand	508-514	7	5
β-strand	517-525	9	5
β-strand	530-534	5	5
β-strand	543-545	3	5
β-strand	552-557	6	6
β-strand	562-567	6	6
β-strand	571-576	6	6
β-strand	582-586	5	6
β-strand	594	1	7
β-strand	598-600	3	8
β-strand	604-607	4	8
β-strand	613-618	6	8
β-strand	626-629	4	8
β-strand	647-652	6	1
β-strand	658-663	6	1
β-strand	668-674	7	1

Chain B: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	9
β-strand	26-31	6	9
β-strand	35-40	6	9
β-strand	55-60	6	9
α-helix	62-64	3
β-strand	71-74	4	10
β-strand	78-83	6	10
β-strand	88-93	6	10
α-helix	96-98	3
β-strand	112-113	2	10
α-helix	115-117	3
β-strand	122-127	6	11
β-strand	131-136	6	11
β-strand	141-145	5	11
β-strand	160-165	6	11
α-helix	167-169	3
β-strand	174-179	6	12
β-strand	183-188	6	12
β-strand	193-197	5	12
β-strand	212-217	6	12
α-helix	224-225	2
β-strand	226-231	6	13
β-strand	235-240	6	13
β-strand	245-249	5	13
β-strand	264-269	6	13
α-helix	271-273	3
β-strand	278-283	6	14
β-strand	287-292	6	14
β-strand	297-301	5	14
β-strand	316-322	7	14
α-helix	323	1
α-helix	325-327	3
α-helix	328-329	2
β-strand	330-335	6	15
β-strand	339-344	6	15
β-strand	349-353	5	15
β-strand	368-373	6	15
β-strand	409	1	7
α-helix	410-411	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase COP1	A	protein	704	Arabidopsis thaliana	P43254 (AlphaFold model)
Ultraviolet-B receptor UVR8	B	protein	468	Arabidopsis thaliana	Q9FN03 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VGG_1 E3 ubiquitin-protein ligase COP1 (chains A)
MDYKDDDDKGDYKDDDDKIDYKDDDDKGSMEEISTDPVVPAVKPDPRTSSVGEGANRHEN
DDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQ
HLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAER
KRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARD
RYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGL
PKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVV
RREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGV
SRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVT
TRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCV
KYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDST
LRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFG
SPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA

Sequence of entity 2 (B), FASTA

>7VGG_2 Ultraviolet-B receptor UVR8 (chains B)
MGSSHHHHHHSSGLVPRGSHSDEVDAHMMAEDMAADEVTAPPRKVLIISAGASHSVALLS
GDIVCSWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSW
GWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQL
GLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDR
LVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEA
LSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGNNLDQCSPVQVRFPDDQKVVQ
VSCGWRHTLAVTERNNVFAWGRGTNGQLGIGESVDRNFPKIIEALSVDGASGQHIESSNI
DPSSGKSWVSPAERYAVVPDETGLTDGSSKGNGGDISVPQTDVKRVRI

Primary citation

Structural insight into UV-B-activated UVR8 bound to COP1. Wang, Y., Wang, L., Guan, Z. et al. Sci Adv (2022) 8:eabn3337-eabn3337. DOI 10.1126/sciadv.abn3337 · PubMed

Other PDB entries of the same protein (UniProt P43254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QTS 1.11 Å, Crystal structure of a mutant Arabidopsis WD40 domain in complex with a photoreceptor
6QTO 1.27 Å, Crystal structure of an Arabidopsis WD40 domain in complex with a transcription factor
6QTQ 1.3 Å, Crystal structure of an Arabidopsis WD40 domain in complex with photoreceptor
6QTU 1.3 Å, Crystal structure of Arabidopsis WD40 domain in complex with a BBX transcription factor
6QTV 1.31 Å, Crystal structure of an Arabidopsis WD40 domain in complex with an atypical bHLH…
6QTR 1.37 Å, Crystal structure of a mutant Arabidopsis WD40 domain in complex with a transcription…
6QTW 1.39 Å, Crystal structure of an Arabidopsis WD40 domain in complex with a blue light photoreceptor
5KWN 1.42 Å, The WD domain ofArabidopsis thaliana E3 Ubiquitin Ligase COP1 in complex with peptide…
6QTT 1.51 Å, Crystal structure of an Arabidopsis WD40 domain in complex with a transcription factor…
5IGO 1.6 Å, WD40 domain of Arabidopsis thaliana E3 Ubiquitin Ligase COP1 in complex with peptide…
6QTX 1.95 Å, Crystal structure of an Arabidopsis WD40 domain in complex with a flowering…

Browse structure collections

About this viewer

MolViewer shows 7VGG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.