7VOE: 5-HT2AR

Crystal structure of 5-HT2AR in complex with aripiprazole. Determined by X-ray diffraction at 2.9 Å resolution. Released 22 Dec 2021.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,919
Mol. weight: 45.26 kDa
Ligands: MG, 9SC, OLC, CLR
Released: 22 Dec 2021

Explore 7VOE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VOE contains 17 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	75-77	3
α-helix	78-101	24
α-helix	103-105	3
α-helix	108-122	15
α-helix	123-127	5
α-helix	128-136	9
β-strand	140	1	1
α-helix	146-177	32
α-helix	189-207	19
α-helix	209-214	6
α-helix	218-220	3
β-strand	222-223	2	1
β-strand	226-227	2	1
α-helix	232-241	10
α-helix	244-1019	41
α-helix	1023-1040	18
α-helix	1067-1081	15
α-helix	1084-348	59
α-helix	355-383	29
α-helix	385-395	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-hydroxytryptamine receptor 2A,Soluble cytochrome b562	A	protein	376	Homo sapiens	P0ABE7 (AlphaFold model), P28223 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VOE_1 5-hydroxytryptamine receptor 2A,Soluble cytochrome b562 (chains A)
GGTHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFL
VMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTAKIWHLCAISLDRYVAIQNPIHHSRF
NSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIP
LTIMVITYFLTIKSLQKEAADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAG
SGSGDILVGQIDDALKLANEGKVKEAQAAAEQLKTTINAYIQKYGQSISNEQKACKVLGI
VFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLNSAVNPLVYTLFNKTY
RSAFSRYIQCQYKENK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
9SC	7-[4-[4-[2,3-bis(chloranyl)phenyl]piperazin-1-yl]butoxy]-3,4-dihydro-1H-quinoli…	C23 H27 Cl2 N3 O2	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	4
CLR	Cholesterol	C27 H46 O	3

Water and common crystallization additives (1PE) are not listed.

Primary citation

Structure-based design of a novel third-generation antipsychotic drug lead with potential antidepressant properties. Chen, Z., Fan, L., Wang, H. et al. Nat Neurosci (2022) 25:39-49. DOI 10.1038/s41593-021-00971-w · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 7VOE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.