The X-ray structure of human neuroglobin A15C mutant. Determined by X-ray diffraction at 1.35 Å resolution. Released 26 Oct 2022.
Explore 7VQG in 3D Show helices and sheets RCSB PDB PDBe
7VQG contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-17 | 12 | |
| α-helix | 20-34 | 15 | |
| α-helix | 36-38 | 3 | |
| α-helix | 39-45 | 7 | |
| α-helix | 52-56 | 5 | |
| α-helix | 59-77 | 19 | |
| α-helix | 82-85 | 4 | |
| α-helix | 86-98 | 13 | |
| α-helix | 105-121 | 17 | |
| α-helix | 122-124 | 3 | |
| α-helix | 127-145 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuroglobin | A | protein | 148 | Homo sapiens | Q9NPG2 (AlphaFold model) |
>7VQG_1 Neuroglobin (chains A) ERPEPELIRQSWRCVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEF LDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCL GPAFTPATRAAWSQLYGAVVQAMSRGWD
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
| DIO | 1,4-diethylene dioxide | C4 H8 O2 | 3 |
Water and common crystallization additives (MES, SO4) are not listed.
The X-ray structure of human neuroglobin A15C mutant. Lin, Y.W. To be published.
Other PDB entries of the same protein (UniProt Q9NPG2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7VQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.