7VVD: Kv7.1 C-terminal Domain

Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation Q135P. Determined by X-ray diffraction at 3.13 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 3.13 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,966
Mol. weight: 50.05 kDa
Ligands: CA
Released: 9 Nov 2022

Explore 7VVD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VVD contains 23 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	367-383	17
α-helix	390-394	5
α-helix	508-530	23

Chain C: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
β-strand	26-27	2	1
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	1
α-helix	65-72	8
α-helix	80-90	11
β-strand	99-100	2	2
α-helix	102-111	10
α-helix	118-127	10
α-helix	135	1
β-strand	136-137	2	2
α-helix	138-146	9

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	367-383	17
α-helix	390-393	4
α-helix	508-530	23

Chain E: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	3
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	3
α-helix	65-72	8
α-helix	82-90	9
β-strand	99-100	2	4
α-helix	102-111	10
α-helix	118-126	9
β-strand	136-137	2	4
α-helix	139-144	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily KQT member 1,Potassium voltage-gated channel subfamily…	A, D	protein	69	Homo sapiens	P51787 (AlphaFold model)
Calmodulin-1	C, E	protein	149	Homo sapiens	P0DP23 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>7VVD_1 Potassium voltage-gated channel subfamily KQT member 1,Potassium voltage-gated channel subfamily KQT member 1 (chains A, D)
FNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRISQLREHHRATIKVIRRMQYFVAKKK
FQQARIGSG

Sequence of entity 2 (C, E), FASTA

>7VVD_2 Calmodulin-1 (chains C, E)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGPVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F141L. Chen, L. To be published.

Other PDB entries of the same protein (UniProt P51787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HFE 1.7 Å, A trimeric form of the Kv7.1 A domain Tail
3BJ4 2.0 Å, The KCNQ1 (Kv7.1) C-terminus, a multi-tiered scaffold for subunit assembly and protein…
7VVH 2.3 Å, Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease…
3HFC 2.45 Å, A trimeric form of the Kv7.1 A domain Tail, L602M/L606M mutant Semet
7XNN 2.5 Å, human KCNQ1-CaM-ML277-PIP2 complex in state B
9UJ4 2.59 Å, Structure of human KCNQ1-CaM complex
7XNK 2.6 Å, human KCNQ1-CaM in complex with ML277
7VUO 2.68 Å, Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease…
9VEC 2.7 Å, structure of human KCNQ1-KCNE1-CaM complex
4V0C 2.86 Å, Crystal Structure of the Kv7.1 proximal C-terminal Domain in Complex with Calmodulin
8SIK 2.9 Å, KCNQ1 with voltage sensor in the up conformation
9U7F 2.9 Å, structure of human KCNQ1-KCNE1-CaM complex

Browse structure collections

About this viewer

MolViewer shows 7VVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.