7VVH: Kv7.1 C-terminal Domain

Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E140G. Determined by X-ray diffraction at 2.3 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,576
Mol. weight: 24.98 kDa
Ligands: CA
Released: 9 Nov 2022

Explore 7VVH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VVH contains 11 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	367-383	17
α-helix	390-394	5
α-helix	508-531	24

Chain C: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	1
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	1
α-helix	65-72	8
α-helix	81-90	10
β-strand	99-101	3	2
α-helix	102-111	10
α-helix	118-128	11
β-strand	135-137	3	2
α-helix	138-145	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily KQT member 1,Potassium voltage-gated channel subfamily…	A	protein	69	Homo sapiens	P51787 (AlphaFold model)
Calmodulin-1	C	protein	149	Homo sapiens	P0DP23 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VVH_1 Potassium voltage-gated channel subfamily KQT member 1,Potassium voltage-gated channel subfamily KQT member 1 (chains A)
FNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRISQLREHHRATIKVIRRMQYFVAKKK
FQQARIGSG

Sequence of entity 2 (C), FASTA

>7VVH_2 Calmodulin-1 (chains C)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEGFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation F141L. Chen, L. To be published.

Other PDB entries of the same protein (UniProt P51787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HFE 1.7 Å, A trimeric form of the Kv7.1 A domain Tail
3BJ4 2.0 Å, The KCNQ1 (Kv7.1) C-terminus, a multi-tiered scaffold for subunit assembly and protein…
3HFC 2.45 Å, A trimeric form of the Kv7.1 A domain Tail, L602M/L606M mutant Semet
7XNN 2.5 Å, human KCNQ1-CaM-ML277-PIP2 complex in state B
9UJ4 2.59 Å, Structure of human KCNQ1-CaM complex
7XNK 2.6 Å, human KCNQ1-CaM in complex with ML277
7VUO 2.68 Å, Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease…
9VEC 2.7 Å, structure of human KCNQ1-KCNE1-CaM complex
4V0C 2.86 Å, Crystal Structure of the Kv7.1 proximal C-terminal Domain in Complex with Calmodulin
8SIK 2.9 Å, KCNQ1 with voltage sensor in the up conformation
9U7F 2.9 Å, structure of human KCNQ1-KCNE1-CaM complex
4UMO 3.0 Å, Crystal Structure of the Kv7.1 proximal C-terminal Domain in Complex with Calmodulin

Browse structure collections

About this viewer

MolViewer shows 7VVH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.