Crystal structure of chromodomain of Arabidopsis LHP1. Determined by X-ray diffraction at 1.7 Å resolution. Released 2 Feb 2022.
Explore 7VZ2 in 3D Show helices and sheets RCSB PDB PDBe
7VZ2 contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 110-119 | 10 | 1 |
| β-strand | 122-129 | 8 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 138-141 | 4 | 1 |
| α-helix | 142-158 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromo domain-containing protein LHP1 | A | protein | 56 | Arabidopsis thaliana | Q946J8 (AlphaFold model) |
>7VZ2_1 Chromo domain-containing protein LHP1 (chains A) GGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSLK
Structural basis for the recognition of methylated histone H3 by the Arabidopsis LHP1 chromodomain. Liu, Y., Yang, X., Zhou, M. et al. J Biol Chem (2022) 298:101623-101623. DOI 10.1016/j.jbc.2022.101623 · PubMed
Other PDB entries of the same protein (UniProt Q946J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7VZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.