7VZE: PTPN4 PDZ

Crystal structure of PTPN4 PDZ bound to the PBM of HPV16 E6. Determined by X-ray diffraction at 2.88 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 2.88 Å
Organisms: Homo sapiens, Human papillomavirus type 16
Chains: 8
Atoms: 2,944
Mol. weight: 45.41 kDa
Released: 2 Mar 2022

Explore 7VZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VZE contains 16 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	516-520	5	1
β-strand	530-535	6	1
β-strand	540-547	8	1
α-helix	559-560	2
α-helix	564	1
β-strand	565-569	5	1
β-strand	573	1	1
α-helix	579-587	9
α-helix	593-595	3
β-strand	597-602	6	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	516-520	5	2
β-strand	530-535	6	2
α-helix	536-538	3
β-strand	540-547	8	2
α-helix	552-555	4
α-helix	559-560	2
α-helix	564	1
β-strand	565-569	5	2
β-strand	573	1	2
α-helix	579-586	8
β-strand	597-602	6	2

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	516-518	3	3
β-strand	530-535	6	3
β-strand	540-547	8	3
α-helix	552-555	4
α-helix	559-560	2
β-strand	565-569	5	3
β-strand	573	1	3
α-helix	574-576	3
α-helix	579-586	8
β-strand	593	1	4
β-strand	596	1	4
β-strand	599-602	4	3

Chain D: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	516-520	5	5
β-strand	530	1	6
β-strand	531-535	5	5
β-strand	540-543	4	5
β-strand	547	1	6
α-helix	552-555	4
α-helix	559-560	2
β-strand	565-569	5	5
β-strand	572-573	2	5
α-helix	579-586	8
β-strand	597-602	6	5

Chains E, F, G and H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	155-157	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 4	A, B, C, D	protein	94	Homo sapiens	P29074 (AlphaFold model)
the PDZ-binding motif of HPV16 E6	E, F, G, H	protein	7	Human papillomavirus type 16	P03126 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7VZE_1 Tyrosine-protein phosphatase non-receptor type 4 (chains A, B, C, D)
GHMDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLI
NGRDIAEHTHDQVVLFIKASCERHSGELMLLVRP

Sequence of entity 2 (E, F, G, H), FASTA

>7VZE_2 the PDZ-binding motif of HPV16 E6 (chains E, F, G, H)
TRRETQL

Primary citation

Structural and biochemical analysis of the PTPN4 PDZ domain bound to the C-terminal tail of the human papillomavirus E6 oncoprotein. Lee, H.S., Yun, H.Y., Lee, E.W. et al. J Microbiol (2022) 60:395-401. DOI 10.1007/s12275-022-1606-1 · PubMed

Other PDB entries of the same protein (UniProt P29074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NFK 1.43 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies…
2VPH 1.9 Å, Crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, PDZ…
3NFL 1.91 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A…
5EYZ 2.09 Å, Crystal structure of the PTPN4 PDZ domain complexed with the tailored peptide CYTO8-retev
5EZ0 2.35 Å, Crystal structure of the PTPN4 PDZ domain complexed with the PDZ binding motif of the…
2I75 2.45 Å, Crystal Structure of Human Protein Tyrosine Phosphatase N4 (PTPN4)
2CS5 Solution structure of PDZ domain of Protein tyrosine phosphatase, non-receptor type 4

Browse structure collections

About this viewer

MolViewer shows 7VZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.