7WLP: Histone H2B type 1-O,Histone H2A type 1-D

Epstein-Barr virus protein BKRF4 restricts nucleosome assembly to suppress host antiviral responses. Determined by X-ray diffraction at 2.29 Å resolution. Released 16 Nov 2022.

Method: X-ray diffraction
Resolution: 2.29 Å
Organisms: Homo sapiens, Human gammaherpesvirus 4
Chains: 4
Atoms: 1,506
Mol. weight: 51.12 kDa
Released: 16 Nov 2022

Explore 7WLP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WLP contains 11 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	22-23	2	1
β-strand	24	1	2
α-helix	25-52	28
β-strand	57-58	2	3
α-helix	60-70	11
α-helix	73-91	19
α-helix	99-103	5
α-helix	109-117	9
β-strand	124-125	2	3
α-helix	128-154	27
β-strand	159-160	2	1
α-helix	162-171	10
α-helix	173-182	10

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	82	1
β-strand	83	1	2
α-helix	84	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2B type 1-O,Histone H2A type 1-D	A	protein	193	Homo sapiens	P20671 (AlphaFold model), P23527 (AlphaFold model)
Tegument protein BKRF4	B, C, D	protein	88	Human gammaherpesvirus 4	Q3KSS1

Sequence of entity 1 (A), FASTA

>7WLP_1 Histone H2B type 1-O,Histone H2A type 1-D (chains A)
MRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITS
REIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKAKTRSSRAGLQFPVGRVHRLLRKGN
YSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLG
KVTIAQGGVLPNI

Sequence of entity 2 (B, C, D), FASTA

>7WLP_2 Tegument protein BKRF4 (chains B, C, D)
MRRLLSDEEEETSQSSSYTLGSQASQSIQEEDVSDTDESDYSDEDEEIDLEEEYPSDEDP
SEGSDSDPSWHPSDSDESDYSESDEDEA

Primary citation

Epstein-Barr virus protein BKRF4 restricts nucleosome assembly to suppress host antiviral responses. Chen, J., Lu, Z., Gong, W. et al. Proc Natl Acad Sci U S A (2022) 119:e2203782119-e2203782119. DOI 10.1073/pnas.2203782119 · PubMed

Other PDB entries of the same protein (UniProt P20671 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KBB 2.37 Å, Role of the DEF/Y motif of Swc5 in histone H2A.Z deposition
5GT3 2.91 Å, Crystal structure of nucleosome particle in the presence of human testis-specific…
8H1T 3.0 Å, Cryo-EM structure of BAP1-ASXL1 bound to chromatosome
7EA8 3.1 Å, Human SETD2 bound to a nucleosome containing oncohistone mutations
9W6Q 3.43 Å, Cryo-EM structure of a stacked human nucleosome core particle trimer assembled with DNA…
9W6F 3.56 Å, Cryo-EM structure of a stacked human nucleosome core particle trimer assembled with DNA…
9W6E 3.7 Å, Cryo-EM structure of a stacked human nucleosome core particle dimer assembled with DNA…
9W6K 3.71 Å, Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1&2, bottom…
9W6G 4.02 Å, Cryo-EM structure of a stacked human nucleosome core particle tetramer assembled with…
9W6O 4.08 Å, Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, top NCP)…
8YJM 4.15 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and a…
8YJF 4.4 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and an…

Browse structure collections

About this viewer

MolViewer shows 7WLP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.