7WSO: Membrane protein G

Structure of a membrane protein G. Determined by electron microscopy at 3.03 Å resolution. Released 31 Aug 2022.

Method: Electron microscopy
Resolution: 3.03 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,204
Mol. weight: 88.71 kDa
Released: 31 Aug 2022

Explore 7WSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WSO contains 24 α-helices and 62 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	34-36	3
β-strand	41-44	4	8
β-strand	50-52	3	9
β-strand	63-69	7	8
β-strand	79-83	5	8
β-strand	91-93	3	9
β-strand	102-109	8	8
α-helix	114-115	2
β-strand	116-117	2	8
β-strand	122-125	4	8
α-helix	142-167	26

Chain B: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	243-247	5	10
α-helix	248-250	3
β-strand	262-268	7	10
β-strand	277-283	7	11
β-strand	286-288	3	11
β-strand	292-293	2	10
β-strand	305-311	7	10
α-helix	314-317	4
β-strand	323-329	7	11
β-strand	336-340	5	11
α-helix	342-344	3
β-strand	348	1	12
β-strand	351-355	5	13
α-helix	356-358	3
β-strand	366-376	11	13
β-strand	377	1	12
β-strand	382-387	6	14
β-strand	390-391	2	14
β-strand	395-397	3	13
α-helix	398-400	3
β-strand	401-402	2	13
β-strand	408-417	10	13
α-helix	418-422	5
β-strand	427-432	6	14
α-helix	437-439	3
β-strand	441-445	5	14
β-strand	452	1	15
α-helix	466-470	5
α-helix	473-489	17

Chain C: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	47-49	3	16
β-strand	53	1	15
β-strand	56	1	7
β-strand	60-66	7	16
β-strand	74-79	6	17
β-strand	87-88	2	17
α-helix	89-92	4
β-strand	96-100	5	16
β-strand	105-110	6	16
α-helix	114-116	3
β-strand	118-125	8	17
β-strand	132-134	3	17
β-strand	138-140	3	17
β-strand	143	1	7
α-helix	151-181	31

Chain K: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	243-247	5	1
α-helix	248-250	3
β-strand	262-268	7	1
β-strand	278-283	6	2
β-strand	286-287	2	2
β-strand	292-293	2	1
β-strand	298	1	3
β-strand	304	1	3
β-strand	305-311	7	1
α-helix	314-317	4
β-strand	323-328	6	2
β-strand	336-340	5	2
α-helix	342-344	3
β-strand	348	1	4
β-strand	351-355	5	5
α-helix	356-358	3
α-helix	359-363	5
β-strand	366-376	11	5
β-strand	377	1	4
β-strand	382-387	6	6
β-strand	390-391	2	6
β-strand	395-397	3	5
α-helix	398-400	3
β-strand	401-402	2	5
β-strand	408-417	10	5
α-helix	418-422	5
β-strand	427-432	6	6
α-helix	437-439	3
β-strand	441-445	5	6
β-strand	459	1	7
α-helix	470-491	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin heavy constant gamma 1	B, K	protein	252	Homo sapiens	P01857 (AlphaFold model)
B-cell antigen receptor complex-associated protein alpha chain	A	protein	137	Homo sapiens	P11912 (AlphaFold model)
B-cell antigen receptor complex-associated protein beta chain	C	protein	139	Homo sapiens	P40259 (AlphaFold model)

Sequence of entity 1 (B, K), FASTA

>7WSO_1 Immunoglobulin heavy constant gamma 1 (chains B, K)
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFL
LSVCYSATVTFF

Sequence of entity 2 (A), FASTA

>7WSO_2 B-cell antigen receptor complex-associated protein alpha chain (chains A)
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLI
IQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIIL
LFCAVVPGTLLLFRKRW

Sequence of entity 3 (C), FASTA

>7WSO_3 B-cell antigen receptor complex-associated protein beta chain (chains C)
SRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNES
LATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIM
IQTLLIILFIIVPIFLLLD

Primary citation

Cryo-EM structures of two human B cell receptor isotypes. Ma, X., Zhu, Y., Chen, Y. et al. Science (2022) 377:880-885. DOI 10.1126/science.abo3828 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement

Browse structure collections

About this viewer

MolViewer shows 7WSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.