7X5D: K316C mutant of Human Lamin A/C Coil 2

Crystal Structure of the K316C mutant of Human Lamin A/C Coil 2 (residues 244-340). Determined by X-ray diffraction at 1.82 Å resolution. Released 8 Mar 2023.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,683
Mol. weight: 23.54 kDa
Released: 8 Mar 2023

Explore 7X5D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7X5D contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	241-335	95

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	245-336	92

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin-A/C	A, B	protein	103	Homo sapiens	P02545 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7X5D_1 Lamin-A/C (chains A, B)
GAMDPEFALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR
IRIDSLSAQLSQLQKQLAACEAKLRDLEDSLARERDTSRRLLA

Primary citation

Atomic structure of the antiparallel four-helix bundle interactions for the formation of lamin filament. Ahn, J., Jo, I., Ha, N.-C. To be published.

Other PDB entries of the same protein (UniProt P02545 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WZZ 1.3 Å, Crystal structure of peptide KAGQVVTIW in complex with HLA-B5801
7X1B 1.4 Å, Crystal structure of peptide KAGQVVTI in complex with HLA-B5801
1IFR 1.4 Å, Structure of Lamin A/C Globular Domain
3GEF 1.5 Å, Crystal structure of the R482W mutant of lamin A/C
8I33 1.62 Å, Coil 1a of lamin A (residue 25-65)
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
7CRG 1.8 Å, Beta-strand-mediated dimeric formation of the extended Ig-like domains of human lamin A/C
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
7YVD 2.1 Å, The crystal structure of the progerin C-terminal peptide and the Ig-like domain of lamin…
1X8Y 2.2 Å, Human lamin coil 2B
6RPR 2.26 Å, LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C

Browse structure collections

About this viewer

MolViewer shows 7X5D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.