7X5F: Nrf2-MafG heterodimer

Nrf2-MafG heterodimer bound with CsMBE2. Determined by X-ray diffraction at 2.6 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, synthetic construct
Chains: 8
Atoms: 4,555
Mol. weight: 70.25 kDa
Released: 9 Nov 2022

Explore 7X5F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7X5F contains 13 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	26-31	6
α-helix	34-37	4
α-helix	46-120	75

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	456-463	8
α-helix	470-475	6
α-helix	478-485	8
α-helix	492-557	66

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	34-39	6
α-helix	47-119	73

Chain F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	456-463	8
α-helix	470-475	6
α-helix	478-487	10
α-helix	492-555	64

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor MafG	A, E	protein	104	Homo sapiens	O15525 (AlphaFold model)
Nuclear factor erythroid 2-related factor 2	B, F	protein	113	Homo sapiens	Q16236 (AlphaFold model)
Synthetic DNA	C, G	DNA	16	synthetic construct
Synthetic DNA	D, H	DNA	16	synthetic construct

Sequence of entity 1 (A, E), FASTA

>7X5F_1 Transcription factor MafG (chains A, E)
MGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEEL
EKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVAR

Sequence of entity 2 (B, F), FASTA

>7X5F_2 Nuclear factor erythroid 2-related factor 2 (chains B, F)
GPHMAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKN
KVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTL

Sequence of entity 3 (C, G), FASTA

>7X5F_3 Synthetic DNA (chains C, G)
GCTGCTGAGTCACTGT

Sequence of entity 4 (D, H), FASTA

>7X5F_4 Synthetic DNA (chains D, H)
CACAGTGACTCAGCAG

Primary citation

Structural basis of transcription regulation by CNC family transcription factor, Nrf2. Sengoku, T., Shiina, M., Suzuki, K. et al. Nucleic Acids Res (2022) 50:12543-12557. DOI 10.1093/nar/gkac1102 · PubMed

Other PDB entries of the same protein (UniProt O15525 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7X5E 2.3 Å, Nrf2-MafG heterodimer bound with CsMBE1
7X5G 2.3 Å, Nrf2 (A510Y)-MafG heterodimer bound with CsMBE2

Browse structure collections

About this viewer

MolViewer shows 7X5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.