7XE6: Endolysin

T4 lysozyme mutant-S44C/C54T/N68C/A93C/C97A/T115C, pH7. Determined by X-ray diffraction at 1.1 Å resolution. Released 22 Mar 2023.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Escherichia virus T4
Chains: 1
Atoms: 1,731
Mol. weight: 19.16 kDa
Ligands: HEZ
Released: 22 Mar 2023

Explore 7XE6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XE6 contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	14-15	2	1
β-strand	16	1	2
β-strand	17-19	3	1
β-strand	25-28	4	1
β-strand	31-32	2	1
α-helix	39-50	12
β-strand	57	1	2
α-helix	60-80	21
α-helix	84-90	7
α-helix	93-106	14
α-helix	108-112	5
α-helix	115-122	8
α-helix	126-133	8
α-helix	137-141	5
α-helix	143-155	13
α-helix	159-161	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endolysin	A	protein	164	Escherichia virus T4	D9IEF7

Sequence of entity 1 (A), FASTA

>7XE6_1 Endolysin (chains A)
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKCELDKAIGRNTNGVITK
DEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFCNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Ligands and cofactors

ID	Name	Formula	Copies
HEZ	Hexane-1,6-diol	C6 H14 O2	2

Water and common crystallization additives (GOL, NA) are not listed.

Primary citation

Creation of Cross-Linked Crystals With Intermolecular Disulfide Bonds Connecting Symmetry-Related Molecules Allows Retention of Tertiary Structure in Different Solvent Conditions. Hiromoto, T., Ikura, T., Honjo, E. et al. Front Mol Biosci (2022) 9:908394-908394. DOI 10.3389/fmolb.2022.908394 · PubMed

Other PDB entries of the same protein (UniProt D9IEF7), best resolution first:

7LOG 0.99 Å, T4 lysozyme mutant L99A in complex with 3-butylpyridine
9DJK 1.04 Å, T4 Lysozyme D127H/V131H
7XE7 1.05 Å, T4 lysozyme mutant-S44C/C54T/N68C/A93C/C97A/T115C, pH10
7LXA 1.07 Å, T4 lysozyme mutant L99A
9DJM 1.08 Å, T4 Lysozyme K147H/T151H
7XEA 1.1 Å, T4 lysozyme mutant-S44C/C54T/N68C/A93C/C97A/T115C, DMSO 40%, and then backsoaking
9DJI 1.1 Å, T4 Lysozyme R119H/Q123H
9DJD 1.11 Å, T4 Lysozyme A73H/G77H/Y139F co-crystallized with Cu(II)-NTA
8F11 1.12 Å, T4 lysozyme with a 2,6-diazaadamantane nitroxide (DZD) spin label
9DJB 1.13 Å, T4 Lysozyme A73H/G77H
9DJC 1.13 Å, T4 Lysozyme A73H/G77H/Y139F
9DJP 1.17 Å, T4 Lysozyme A73H/G77H/R119H/Q123H co-crystallized with Cu(II)-NTA

Browse structure collections

About this viewer

MolViewer shows 7XE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.