7XF6: Human Lysozyme

Crystal Structure of Human Lysozyme. Determined by X-ray diffraction at 1.3 Å resolution. Released 13 Apr 2022.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,296
Mol. weight: 14.78 kDa
Released: 13 Apr 2022

Explore 7XF6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XF6 contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	1
α-helix	23-32	10
β-strand	38	1	2
β-strand	41	1	2
α-helix	43-54	12
β-strand	57	1	1
β-strand	61-64	4	3
β-strand	69-72	4	3
β-strand	77-78	2	3
β-strand	84	1	4
β-strand	98	1	4
α-helix	99-103	5
α-helix	108-118	11
α-helix	123-126	4
α-helix	128-133	6
α-helix	140-143	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysozyme C	A	protein	130	Homo sapiens	P61626 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XF6_1 Lysozyme C (chains A)
KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQIN
SRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRD
VRQYVQGCGV

Primary citation

Crystal Structure of Human Lysozyme Complexed with N-Acetyl-alpha-d-glucosamine. Nam, K.H. Appl Sci (Basel) (2022) 12. DOI 10.3390/app12094363

Other PDB entries of the same protein (UniProt P61626 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NWD 1.04 Å, Structure of chemically synthesized human lysozyme at 1 Angstrom resolution
5LSH 1.06 Å, human lysozyme in complex with a tetrasaccharide fragment of the O-chain of LPS from…
1JSF 1.15 Å, Full-matrix least-squares refinement of human lysozyme
7AP7 1.15 Å, Structure of the W64R amyloidogenic variant of human lysozyme
1IWT 1.4 Å, Crystal Structure Analysis of Human lysozyme at 113K.
1IWU 1.4 Å, Crystal Structure Analysis of Human lysozyme at 127K.
1IWV 1.4 Å, Crystal Structure Analysis of Human lysozyme at 147K.
1IWW 1.4 Å, Crystal Structure Analysis of Human lysozyme at 152K.
1IWX 1.4 Å, Crystal Structure Analysis of Human lysozyme at 161K.
1IWY 1.4 Å, Crystal Structure Analysis of Human lysozyme at 170K.
1JWR 1.4 Å, Crystal structure of human lysozyme at 100 K
6LFH 1.46 Å, X-ray crystal structure of chemically synthesized human lysozyme

Browse structure collections

About this viewer

MolViewer shows 7XF6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.