7XHF: NTF2L domain of human G3BP1

Crystal structure of the NTF2L domain of human G3BP1 in complex with the USP10 derived peptide. Determined by X-ray diffraction at 2.68 Å resolution. Released 18 Jan 2023.

Method: X-ray diffraction
Resolution: 2.68 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,271
Mol. weight: 35.7 kDa
Released: 18 Jan 2023

Explore 7XHF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XHF contains 11 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-41	8	1
α-helix	53-54	2
β-strand	55-56	2	1
α-helix	57-67	11
β-strand	74-84	11	1
β-strand	90-99	10	1
β-strand	106-116	11	1
β-strand	123-133	11	1
α-helix	134-136	3

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	2
β-strand	45	1	3
α-helix	50	1
β-strand	51	1	3
α-helix	52-54	3
β-strand	55-56	2	2
α-helix	58-66	9
β-strand	74-84	11	2
β-strand	90-99	10	2
β-strand	105-116	12	2
β-strand	123-133	11	2
α-helix	134-136	3

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9-10	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras GTPase-activating protein-binding protein 1	A, B	protein	139	Homo sapiens	Q13283 (AlphaFold model)
USP10/6-21	C, D	protein	16	Homo sapiens	Q14694 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7XHF_1 Ras GTPase-activating protein-binding protein 1 (chains A, B)
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKE
IHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSV
ANKFYVHNDIFRYQDEVFG

Sequence of entity 2 (C, D), FASTA

>7XHF_2 USP10/6-21 (chains C, D)
PQYIFGDFSPDEFNQF

Primary citation

Yin and yang regulation of stress granules by Caprin-1. Song, D., Kuang, L., Yang, L. et al. Proc Natl Acad Sci U S A (2022) 119:e2207975119-e2207975119. DOI 10.1073/pnas.2207975119 · PubMed

Other PDB entries of the same protein (UniProt Q13283 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FCJ 1.62 Å, Crystal structure of the NTF2-like domain of human G3BP1
3Q90 1.7 Å, Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
8TH1 1.8 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
5FW5 1.92 Å, Crystal structure of human G3BP1 in complex with Semliki Forest Virus nsP3-25 comprising…
6TA7 1.93 Å, Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif
8TH6 2.34 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to USP10 peptide
7SUO 2.35 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
7S17 2.36 Å, Crystal structure of human G3BP1-NTF2 with three mutations- F15W, F33W, and F124W
9CC6 2.4 Å, De novo design of high-affinity protein binders to RNA binding domain of G3bp1
7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
8TH5 2.62 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
9IVQ 2.66 Å, Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1…

Browse structure collections

About this viewer

MolViewer shows 7XHF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.