7YIM: Human Alpha-fetoprotein

Cryo-EM structure of human Alpha-fetoprotein. Determined by electron microscopy at 2.6 Å resolution. Released 18 Jan 2023.

Method: Electron microscopy
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,657
Mol. weight: 68.76 kDa
Released: 18 Jan 2023

Explore 7YIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YIM contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	19-21	3
α-helix	31-33	3
α-helix	43-54	12
α-helix	60-74	15
α-helix	91-100	10
α-helix	102-107	6
α-helix	112-115	4
α-helix	118-127	10
α-helix	144-153	10
α-helix	155-167	13
α-helix	175-192	18
α-helix	198-230	33
α-helix	232-246	15
α-helix	252-270	19
α-helix	274-289	16
α-helix	302-304	3
α-helix	307-316	10
α-helix	322-323	2
α-helix	344-360	17
α-helix	367-384	18
α-helix	390-398	9
α-helix	403-438	36
α-helix	444-461	18
α-helix	468-490	23
α-helix	495-502	8
α-helix	508-513	6
α-helix	528-530	3
α-helix	543-559	17
α-helix	566-581	16
α-helix	588-591	4
α-helix	592-596	5
α-helix	597-607	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-fetoprotein	A	protein	609	Homo sapiens	P02771 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7YIM_1 Alpha-fetoprotein (chains A)
MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATY
KEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG
RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILL
WAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITV
TKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKIT
ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSR
RHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ
KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADII
IGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQA
QGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLI
SKTRAALGV

Primary citation

Uniform thin ice on ultraflat graphene for high-resolution cryo-EM. Zheng, L., Liu, N., Gao, X. et al. Nat Methods (2023) 20:123-130. DOI 10.1038/s41592-022-01693-y · PubMed

Other PDB entries of the same protein (UniProt P02771 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MRK 1.4 Å, Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
7RE7 2.55 Å, TCR mimic antibody (Fab fragment) in complex with AFP/HLA-A*02
7RE8 2.82 Å, Class I MHC (HLA-A*02) presenting alpha fetoprotein peptide (AFP)
8X1N 3.31 Å, Cryo-EM structure of human alpha-fetoprotein

Browse structure collections

About this viewer

MolViewer shows 7YIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.