7YXC: WT AncGR2-LBD

Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment. Determined by X-ray diffraction at 2.25 Å resolution. Released 7 Dec 2022.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: unidentified, Homo sapiens
Chains: 2
Atoms: 2,146
Mol. weight: 30.56 kDa
Ligands: CO3, DEX
Released: 7 Dec 2022

Explore 7YXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YXC contains 13 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-539	8
α-helix	540-545	6
α-helix	556-579	24
α-helix	584-586	3
α-helix	589-616	28
β-strand	621-624	4	1
β-strand	627-629	3	1
α-helix	631-634	4
α-helix	639-656	18
α-helix	660-671	12
β-strand	674-676	3	2
α-helix	683-702	20
α-helix	711-741	31
α-helix	743-745	3
α-helix	751-765	15
β-strand	769-771	3	2

Chain R: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-25	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ancestral Glucocorticoid Receptor2	A	protein	248	unidentified	A0A1X8XLE9 (AlphaFold model)
SHP NR Box 1 Peptide	R	protein	11	Homo sapiens	Q15466 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7YXC_1 Ancestral Glucocorticoid Receptor2 (chains A)
FPTLISLLEVIEPEVLYSGYDSTLPDTSTRLMSTLNRLGGRQVVSAVKWAKALPGFRNLH
LDDQMTLLQYSWMSLMAFSLGWRSYKQSNGNMLCFAPDLVINEERMQLPYMYDQCQQMLK
ISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIKELGKAIVKREGNS
SQNWQRFYQLTKLLDSMHEMVGGLLQFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGS
VKPLLFHQ

Sequence of entity 2 (R), FASTA

>7YXC_2 SHP NR Box 1 Peptide (chains R)
RPAILYALLSS

Ligands and cofactors

ID	Name	Formula	Copies
CO3	Carbonate ion	C O3	2
DEX	Dexamethasone	C22 H29 F O5	1

Water and common crystallization additives (PG4) are not listed.

Primary citation

The multivalency of the glucocorticoid receptor ligand-binding domain explains its manifold physiological activities. Jimenez-Panizo, A., Alegre-Marti, A., Tettey, T.T. et al. Nucleic Acids Res (2022) 50:13063-13082. DOI 10.1093/nar/gkac1119 · PubMed

Other PDB entries of the same protein (UniProt A0A1X8XLE9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W9L 1.45 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
6W9M 1.59 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
6W9K 1.6 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
5UFS 2.12 Å, X-Ray Crystal Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain…
7YXD 2.3 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXN 2.46 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXR 2.5 Å, Crystal structure of mutant AncGR2-LBD (Y545A) bound to dexamethasone and SHP…
7YXO 2.99 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXP 3.36 Å, Crystal structure of WT AncGR2-LBD WT bound to dexamethasone and SHP coregulator fragment

Browse structure collections

About this viewer

MolViewer shows 7YXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.