Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment. Determined by X-ray diffraction at 2.46 Å resolution. Released 7 Dec 2022.
Explore 7YXN in 3D Show helices and sheets RCSB PDB PDBe
7YXN contains 26 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 529-531 | 3 | |
| α-helix | 532-539 | 8 | |
| α-helix | 541-544 | 4 | |
| α-helix | 556-579 | 24 | |
| α-helix | 584-586 | 3 | |
| α-helix | 589-616 | 28 | |
| β-strand | 621-624 | 4 | 1 |
| β-strand | 627-629 | 3 | 1 |
| α-helix | 639-655 | 17 | |
| α-helix | 660-671 | 12 | |
| β-strand | 674-676 | 3 | 2 |
| α-helix | 683-702 | 20 | |
| α-helix | 713-741 | 29 | |
| α-helix | 743-745 | 3 | |
| α-helix | 751-765 | 15 | |
| β-strand | 769-771 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 528-531 | 4 | |
| α-helix | 532-539 | 8 | |
| α-helix | 541-544 | 4 | |
| α-helix | 556-579 | 24 | |
| α-helix | 584-586 | 3 | |
| α-helix | 589-616 | 28 | |
| β-strand | 621-624 | 4 | 3 |
| β-strand | 627-629 | 3 | 3 |
| α-helix | 639-655 | 17 | |
| α-helix | 660-671 | 12 | |
| β-strand | 674-676 | 3 | 4 |
| α-helix | 683-702 | 20 | |
| α-helix | 712-741 | 30 | |
| α-helix | 743-745 | 3 | |
| α-helix | 751-765 | 15 | |
| β-strand | 769-771 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-26 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ancestral Glucocorticoid Receptor2 | A, C | protein | 250 | unidentified | A0A1X8XLE9 (AlphaFold model) |
| SHP NR Box 1 Peptide | R, S | protein | 11 | Homo sapiens | Q15466 (AlphaFold model) |
>7YXN_1 Ancestral Glucocorticoid Receptor2 (chains A, C) GEFPTLISLLEVIEPEVLYSGYDSTLPDTSTRLMSTLNRLGGRQVVSAVKWAKALPGFRN LHLDDQMTLLQYSWMSLMAFSLGWRSYKQSNGNMLCFAPDLVINEERMQLPYMYDQCQQM LKISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIKELGKAIVKREG NSSQNWQRFYQLTKLLDSMHEMVGGLLQFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKA GSVKPLLFHQ
>7YXN_2 SHP NR Box 1 Peptide (chains R, S) RPAILYALLSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| DEX | Dexamethasone | C22 H29 F O5 | 2 |
Water and common crystallization additives (FMT) are not listed.
The multivalency of the glucocorticoid receptor ligand-binding domain explains its manifold physiological activities. Jimenez-Panizo, A., Alegre-Marti, A., Tettey, T.T. et al. Nucleic Acids Res (2022) 50:13063-13082. DOI 10.1093/nar/gkac1119 · PubMed
Other PDB entries of the same protein (UniProt A0A1X8XLE9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7YXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.