BRD4 in complex with FragLite2. Determined by X-ray diffraction at 1.04 Å resolution. Released 7 Dec 2022.
Explore 7Z9Y in 3D Show helices and sheets RCSB PDB PDBe
7Z9Y contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 45-49 | 5 | |
| α-helix | 61-65 | 5 | |
| α-helix | 66-71 | 6 | |
| α-helix | 72-75 | 4 | |
| α-helix | 81-83 | 3 | |
| α-helix | 97-100 | 4 | |
| α-helix | 107-115 | 9 | |
| α-helix | 122-139 | 18 | |
| α-helix | 141 | 1 | |
| α-helix | 145-162 | 18 | |
| α-helix | 164-167 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Isoform C of Bromodomain-containing protein 4 | AAA | protein | 129 | Homo sapiens | O60885 (AlphaFold model) |
>7Z9Y_1 Isoform C of Bromodomain-containing protein 4 (chains AAA) GSHMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYK IIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQ KINELPTEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| PYZ | 4-iodopyrazole | C3 H3 I N2 | 2 |
Water and common crystallization additives (GOL) are not listed.
Mapping Ligand Interactions of Bromodomains BRD4 and ATAD2 with FragLites and PepLites─Halogenated Probes of Druglike and Peptide-like Molecular Interactions. Davison, G., Martin, M.P., Turberville, S. et al. J Med Chem (2022) 65:15416-15432. DOI 10.1021/acs.jmedchem.2c01357 · PubMed
Other PDB entries of the same protein (UniProt O60885 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7Z9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.