Structure of human USPL1 in covalent complex with DeltaN-SUMO2/3-PA probe. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Sept 2023.
Explore 7ZJV in 3D Show helices and sheets RCSB PDB PDBe
7ZJV contains 13 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 227 | 1 | 1 |
| α-helix | 229-231 | 3 | |
| α-helix | 236-246 | 11 | |
| α-helix | 249-257 | 9 | |
| α-helix | 265-281 | 17 | |
| α-helix | 298-323 | 26 | |
| α-helix | 333-341 | 9 | |
| α-helix | 345-348 | 4 | |
| β-strand | 353-360 | 8 | 2 |
| β-strand | 367-374 | 8 | 2 |
| β-strand | 377-379 | 3 | 3 |
| β-strand | 382 | 1 | 2 |
| β-strand | 387 | 1 | 4 |
| β-strand | 390 | 1 | 4 |
| β-strand | 391-395 | 5 | 2 |
| β-strand | 405-413 | 9 | 2 |
| β-strand | 418-422 | 5 | 3 |
| α-helix | 431-434 | 4 | |
| β-strand | 436-438 | 3 | 5 |
| β-strand | 441-443 | 3 | 5 |
| β-strand | 444-452 | 9 | 3 |
| β-strand | 456-462 | 7 | 3 |
| β-strand | 468-471 | 4 | 3 |
| α-helix | 473-475 | 3 | |
| β-strand | 478 | 1 | 1 |
| β-strand | 480-482 | 3 | 3 |
| α-helix | 489-491 | 3 | |
| β-strand | 492-498 | 7 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-23 | 7 | 6 |
| β-strand | 28-33 | 6 | 6 |
| α-helix | 40-50 | 11 | |
| α-helix | 54-56 | 3 | |
| β-strand | 57-61 | 5 | 6 |
| β-strand | 64-65 | 2 | 6 |
| α-helix | 77-78 | 2 | |
| β-strand | 81-87 | 7 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUMO-specific isopeptidase USPL1 | A | protein | 287 | Homo sapiens | Q5W0Q7 (AlphaFold model) |
| Small ubiquitin-related modifier 2 | B | protein | 76 | Homo sapiens | P61956 (AlphaFold model) |
>7ZJV_1 SUMO-specific isopeptidase USPL1 (chains A) GPCTSFPQALCVQWKNAYALCWLDCILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQ ANTLLYTSQLSGVKDGDCKKLTSEIFAEIETCLNEVRDEIFISLQPQLRCTLGDMESPVF AFPLLLKLETHIEKLFLYSFSWDFECSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAAHFG PCNNCNSKSQIRKMVLEKVSPIFMLHFVEGLPQNDLQHYAFHFEGCLYQITSVIQYRANN HFITWILDADGSWLECDDLKGPCSERHKKFEVPASEIHIVIWERKIS
>7ZJV_2 Small ubiquitin-related modifier 2 (chains B) MINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQL EMEDEDTIDVFQQQTG
Water and common crystallization additives (CL) are not listed.
Native Semisynthesis of Isopeptide-Linked Substrates for Specificity Analysis of Deubiquitinases and Ubl Proteases. Zhao, Z., O'Dea, R., Wendrich, K. et al. J Am Chem Soc (2023) 145:20801-20812. DOI 10.1021/jacs.3c04062 · PubMed
Other PDB entries of the same protein (UniProt Q5W0Q7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ZJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.