7ZLY: PDB entry 7ZLY

Crystal structure of human GPCR Niacin receptor (HCA2) expressed from Spodoptera frugiperda. Determined by X-ray diffraction at 2.7 Å resolution. Released 12 Apr 2023.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 3,182
Mol. weight: 51.87 kDa
Ligands: OLA, OLC
Released: 12 Apr 2023

Explore 7ZLY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZLY contains 17 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	1
β-strand	18-19	2	1
α-helix	24-50	27
α-helix	51-55	5
α-helix	61-88	28
α-helix	97-129	33
α-helix	135-138	4
α-helix	141-159	19
α-helix	160-163	4
β-strand	169-170	2	2
β-strand	175-176	2	2
α-helix	188-237	50
α-helix	244-262	19
α-helix	278-299	22
α-helix	303-309	7
α-helix	312-320	9
α-helix	322-366	45
α-helix	372-375	4
α-helix	376-389	14
α-helix	392-401	10
α-helix	406-416	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hydroxycarboxylic acid receptor 2,Soluble cytochrome b562	A	protein	431	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), Q8TDS4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ZLY_1 Hydroxycarboxylic acid receptor 2,Soluble cytochrome b562 (chains A)
MNRHHLQDHFLEIDKKNCCVFRDDFIVKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK
SSRIFLFNLVVADFLLIICLPFLMDNYVRRWDWKFGDIPCRLMLFMLAMNRQGSIIFLTV
VAVDRYFRVVHPHHALNKISNRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSF
SICHTFQWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQADLEDNWETLNDNLKVIEKAD
NAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANE
GKVKEAQAAAEQLKTTRNAYIQKYLMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIRI
FWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNVMLDPVVYYFSSPSFPNFFSTLINRCLQ
RKMTGEPDNNR

Ligands and cofactors

ID	Name	Formula	Copies
OLA	Oleic acid	C18 H34 O2	6
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	1

Primary citation

Structural insights into the human niacin receptor HCA2-G i signalling complex. Yang, Y., Kang, H.J., Gao, R. et al. Nat Commun (2023) 14:1692-1692. DOI 10.1038/s41467-023-37177-6 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 7ZLY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.