Clathrin N-terminal domain in complex with a HURP phospho-peptide. Determined by X-ray diffraction at 2.08 Å resolution. Released 29 Mar 2023.
Explore 7ZX4 in 3D Show helices and sheets RCSB PDB PDBe
7ZX4 contains 20 α-helices and 59 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-14 | 8 | 1 |
| α-helix | 15-18 | 4 | |
| α-helix | 22-24 | 3 | |
| β-strand | 30-34 | 5 | 2 |
| β-strand | 37-43 | 7 | 2 |
| β-strand | 48-54 | 7 | 2 |
| β-strand | 62-66 | 5 | 2 |
| β-strand | 70-73 | 4 | 3 |
| β-strand | 79-84 | 6 | 3 |
| β-strand | 87-92 | 6 | 3 |
| β-strand | 97-103 | 7 | 3 |
| β-strand | 110-113 | 4 | 4 |
| β-strand | 118-122 | 5 | 4 |
| β-strand | 126-131 | 6 | 4 |
| β-strand | 139-143 | 5 | 4 |
| α-helix | 144-145 | 2 | |
| α-helix | 146-148 | 3 | |
| α-helix | 151 | 1 | |
| β-strand | 152-158 | 7 | 5 |
| β-strand | 164-173 | 10 | 5 |
| β-strand | 176-185 | 10 | 5 |
| β-strand | 190-195 | 6 | 5 |
| β-strand | 198-204 | 7 | 6 |
| β-strand | 213-222 | 10 | 6 |
| β-strand | 225-232 | 8 | 6 |
| α-helix | 235-237 | 3 | |
| α-helix | 240-245 | 6 | |
| β-strand | 246-250 | 5 | 6 |
| β-strand | 261-267 | 7 | 7 |
| β-strand | 272-277 | 6 | 7 |
| β-strand | 281-286 | 6 | 7 |
| β-strand | 292-297 | 6 | 7 |
| β-strand | 303-309 | 7 | 1 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-319 | 6 | 1 |
| β-strand | 323-329 | 7 | 1 |
| α-helix | 334-340 | 7 | |
| α-helix | 345-354 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-14 | 8 | 8 |
| α-helix | 15-18 | 4 | |
| α-helix | 22-24 | 3 | |
| β-strand | 30-34 | 5 | 9 |
| β-strand | 37-44 | 8 | 9 |
| β-strand | 47-54 | 8 | 9 |
| β-strand | 62-65 | 4 | 9 |
| β-strand | 66 | 1 | 10 |
| β-strand | 70-73 | 4 | 11 |
| β-strand | 79-84 | 6 | 11 |
| β-strand | 87-92 | 6 | 11 |
| β-strand | 97-103 | 7 | 11 |
| β-strand | 110-113 | 4 | 12 |
| β-strand | 118-122 | 5 | 12 |
| β-strand | 126-131 | 6 | 12 |
| β-strand | 139-143 | 5 | 12 |
| α-helix | 144-145 | 2 | |
| α-helix | 146-148 | 3 | |
| α-helix | 151 | 1 | |
| β-strand | 152-158 | 7 | 13 |
| β-strand | 164-173 | 10 | 13 |
| β-strand | 176-185 | 10 | 13 |
| β-strand | 190-195 | 6 | 13 |
| β-strand | 198-204 | 7 | 14 |
| β-strand | 213-221 | 9 | 14 |
| β-strand | 226-232 | 7 | 14 |
| α-helix | 235-237 | 3 | |
| α-helix | 240-245 | 6 | |
| β-strand | 246-250 | 5 | 14 |
| β-strand | 261-267 | 7 | 15 |
| β-strand | 272-277 | 6 | 15 |
| β-strand | 281-286 | 6 | 15 |
| β-strand | 292-297 | 6 | 15 |
| β-strand | 303-309 | 7 | 8 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-319 | 6 | 8 |
| β-strand | 323-329 | 7 | 8 |
| α-helix | 334-340 | 7 | |
| α-helix | 345-353 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Clathrin heavy chain 1 | A, B | protein | 364 | Homo sapiens | Q00610 (AlphaFold model) |
| Disks large-associated protein 5 | C, D, E | protein | 21 | Homo sapiens | Q15398 (AlphaFold model) |
>7ZX4_1 Clathrin heavy chain 1 (chains A, B) MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA EELF
>7ZX4_2 Disks large-associated protein 5 (chains C, D, E) YRHISFGGNLITFSPLQPGEF
Large-scale phosphomimetic screening identifies phospho-modulated motif-based protein interactions. Kliche, J., Garvanska, D.H., Simonetti, L. et al. Mol Syst Biol (2023) 19:e11164-e11164. DOI 10.15252/msb.202211164 · PubMed
Other PDB entries of the same protein (UniProt Q00610 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ZX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.