7ZXK: Human IL-27

Human IL-27 in complex with neutralizing SRF388 FAb fragment. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 8
Atoms: 12,892
Mol. weight: 192.67 kDa
Ligands: NAG
Released: 2 Nov 2022

Explore 7ZXK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZXK contains 59 α-helices and 132 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	40-72	33
β-strand	92-93	2	1
α-helix	94-98	5
α-helix	102-111	10
α-helix	114-119	6
α-helix	120-122	3
α-helix	131-157	27
α-helix	199-225	27

Chain B: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	34-36	3	2
β-strand	37	1	3
β-strand	38-39	2	2
β-strand	43-47	5	2
β-strand	64-67	4	4
β-strand	77-78	2	4
β-strand	80	1	2
β-strand	88-92	5	2
β-strand	95-96	2	1
α-helix	101	1
β-strand	102-106	5	4
β-strand	117-121	5	4
α-helix	124-126	3
β-strand	127	1	3
α-helix	129-132	4
β-strand	133-140	8	5
β-strand	144-150	7	5
β-strand	163-171	9	6
β-strand	178-183	6	6
β-strand	187-190	4	5
α-helix	193-194	2
β-strand	198-207	10	6
α-helix	214-220	7
β-strand	221-224	4	6

Chain C: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	40-72	33
α-helix	78-80	3
α-helix	81-83	3
β-strand	92-93	2	7
α-helix	94-97	4
α-helix	102-111	10
α-helix	116-119	4
α-helix	120-122	3
α-helix	131-157	27
α-helix	197-224	28

Chain D: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	32-36	5	8
β-strand	37	1	9
β-strand	38-39	2	8
β-strand	43-49	7	8
β-strand	63-67	5	10
β-strand	77-78	2	10
β-strand	80	1	8
β-strand	88-92	5	8
α-helix	94	1
β-strand	95-96	2	7
α-helix	101	1
β-strand	102-107	6	10
β-strand	117-121	5	10
β-strand	127	1	9
α-helix	129-132	4
β-strand	133-140	8	11
β-strand	144-150	7	11
β-strand	163-171	9	12
β-strand	178-183	6	12
β-strand	187-190	4	11
β-strand	198-207	10	12
α-helix	214-220	7
β-strand	221-224	4	12

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	13
β-strand	10-12	3	14
β-strand	18-25	8	13
α-helix	29-31	3
β-strand	34-39	6	14
β-strand	45-51	7	14
β-strand	58-60	3	14
α-helix	62-64	3
β-strand	68-73	6	13
β-strand	78-83	6	13
α-helix	88-90	3
β-strand	92-99	8	14
β-strand	113-116	4	14
β-strand	120-124	5	14
α-helix	128-129	2
β-strand	130	1	15
α-helix	131-132	2
β-strand	133-137	5	16
β-strand	145	1	16
β-strand	148-158	11	16
β-strand	159	1	15
β-strand	164-167	4	17
β-strand	176-178	3	16
α-helix	179-181	3
β-strand	182-183	2	16
β-strand	189-198	10	16
α-helix	199-201	3
β-strand	207-213	7	17
α-helix	214-216	3
β-strand	218-224	7	17

Chain I: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	18
β-strand	10-14	5	19
β-strand	19-25	7	18
β-strand	30-31	2	20
β-strand	36-37	2	20
β-strand	39-44	6	19
β-strand	51-55	5	19
β-strand	59-60	2	19
α-helix	61	1
β-strand	68-73	6	18
β-strand	76-81	6	18
α-helix	86-88	3
β-strand	90-96	7	19
α-helix	102	1
β-strand	103-104	2	19
β-strand	108-113	6	19
β-strand	117	1	21
α-helix	118-119	2
β-strand	120-124	5	22
α-helix	125-127	3
α-helix	128-133	6
β-strand	135-145	11	22
β-strand	146	1	21
β-strand	150-156	7	23
β-strand	160	1	23
β-strand	165-169	5	22
α-helix	170-173	4
β-strand	179-188	10	22
α-helix	189-193	5
β-strand	197-204	8	23
β-strand	211-216	6	23

Chain J: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	24
β-strand	10-12	3	25
β-strand	18-25	8	24
α-helix	29-31	3
β-strand	34-39	6	25
β-strand	45-51	7	25
β-strand	58-60	3	25
α-helix	62-64	3
β-strand	68-73	6	24
α-helix	74-76	3
β-strand	78-83	6	24
α-helix	88-90	3
β-strand	92-99	8	25
β-strand	107	1	26
β-strand	110	1	26
β-strand	113-116	4	25
β-strand	120-124	5	25
α-helix	127-129	3
β-strand	130	1	27
α-helix	131-132	2
β-strand	133-137	5	28
α-helix	138-140	3
β-strand	148-158	11	28
β-strand	159	1	27
β-strand	164-167	4	29
β-strand	172	1	29
β-strand	176-178	3	28
α-helix	179-181	3
β-strand	182-183	2	28
β-strand	189-198	10	28
α-helix	199-201	3
β-strand	208-213	6	29
α-helix	214-216	3
β-strand	218-223	6	29

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	30
β-strand	10-14	5	31
β-strand	19-25	7	30
β-strand	30-31	2	32
β-strand	36-37	2	32
β-strand	39-44	6	31
β-strand	51-55	5	31
β-strand	59-60	2	31
α-helix	61	1
β-strand	68-73	6	30
β-strand	76-81	6	30
α-helix	86-88	3
β-strand	90-96	7	31
α-helix	102	1
β-strand	103-104	2	31
β-strand	108-113	6	31
β-strand	117	1	33
α-helix	118-119	2
β-strand	120-124	5	34
α-helix	125-127	3
α-helix	128-131	4
β-strand	135-145	11	34
β-strand	146	1	33
β-strand	150-156	7	35
β-strand	159-160	2	35
β-strand	165-169	5	34
α-helix	170-173	4
β-strand	179-188	10	34
α-helix	189-193	5
β-strand	197-204	8	35
β-strand	211-216	6	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-27 subunit alpha	A, C	protein	215	Homo sapiens	Q8NEV9 (AlphaFold model)
Interleukin-27 subunit beta	B, D	protein	209	Homo sapiens	Q14213 (AlphaFold model)
SRF388 Heavy Chain	H, J	protein	229	Homo sapiens
SRF388 Light Chain	I, L	protein	220	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>7ZXK_1 Interleukin-27 subunit alpha (chains A, C)
FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLP
DVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQ
RHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLH
SLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

Sequence of entity 2 (B, D), FASTA

>7ZXK_2 Interleukin-27 subunit beta (chains B, D)
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCL
QQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYY
VQVAAQDLTDYGELSDWSLPATATMSLGK

Sequence of entity 3 (H, J), FASTA

>7ZXK_3 SRF388 Heavy Chain (chains H, J)
EVQLVESGGGLVKPGGSLRLSCAASGFTFRSYGMNWVRQAPGKGLEWVSGISSSGSYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDGGRTSYTATAHNWFDPWGQGT
LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 4 (I, L), FASTA

>7ZXK_4 SRF388 Light Chain (chains I, L)
DIVMTQSPDSLAVSLGERATINCKSSQSVLFSSNNKNYLAWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQHASAPPTFGGGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structural basis of activation and antagonism of receptor signaling mediated by interleukin-27. Skladanowska, K., Bloch, Y., Strand, J. et al. Cell Rep (2022) 41:111490-111490. DOI 10.1016/j.celrep.2022.111490 · PubMed

Other PDB entries of the same protein (UniProt Q8NEV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XWY 3.4 Å, Structure of Interleukin-27
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8D85 3.81 Å, Cryo-EM structure of human IL-27 signaling complex: model containing the interaction…

Browse structure collections

About this viewer

MolViewer shows 7ZXK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.