8A38: RING domain of human TRIM2

RING domain of human TRIM2. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 Sept 2023.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,698
Mol. weight: 32.82 kDa
Ligands: ZN
Released: 20 Sept 2023

Explore 8A38 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A38 contains 18 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
β-strand	29	1	1
β-strand	33-35	3	2
β-strand	41-43	3	2
α-helix	44-50	7
α-helix	52	1
β-strand	57-59	3	3
β-strand	66-68	3	3
α-helix	69-70	2
α-helix	74-76	3
α-helix	78	1
β-strand	79	1	2
α-helix	81-89	9

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	4
β-strand	29	1	4
β-strand	33-35	3	5
β-strand	41-43	3	5
α-helix	44-50	7
α-helix	52	1
β-strand	57-59	3	6
β-strand	66-68	3	6
α-helix	69-70	2
α-helix	74-76	3
α-helix	78	1
β-strand	79	1	5
α-helix	81-88	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing protein 2	A, B, C	protein	96	Homo sapiens	Q9C040 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8A38_1 Tripartite motif-containing protein 2 (chains A, B, C)
GAMIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCR
QTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	7

Primary citation

Structural and biophysical studies of TRIM2 and TRIM3. Perez-Borrajero, C., Hennig, J. To be published.

Other PDB entries of the same protein (UniProt Q9C040 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QRV 1.45 Å, Crystal structure of NHL domain of TRIM2 (full C-terminal)
7B2R 1.6 Å, Crystal structure of NHL domain of TRIM2
7B96 1.8 Å, NHL domain of human TRIM2
8AMS 2.4 Å, Complex of human TRIM2 RING domain, UBCH5C, and Ubiquitin
7ZJ3 2.53 Å, Structure of TRIM2 RING domain in complex with UBE2D1~Ub conjugate

Browse structure collections

About this viewer

MolViewer shows 8A38 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.