8AH5: PDB entry 8AH5

Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121 at pH 4.6. Determined by X-ray diffraction at 1.25 Å resolution. Released 8 Mar 2023.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,004
Mol. weight: 11.27 kDa
Released: 8 Mar 2023

Explore 8AH5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AH5 contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	302	1	1
β-strand	308	1	1
β-strand	312-317	6	2
β-strand	325-331	7	2
β-strand	334-341	8	2
α-helix	346-350	5
β-strand	357-362	6	2
β-strand	365-366	2	2
α-helix	372-380	9
β-strand	385-392	8	2
α-helix	394-401	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cDNA FLJ50577, highly similar to Discs large homolog 4	A	protein	104	Homo sapiens	P78352 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8AH5_1 cDNA FLJ50577, highly similar to Discs large homolog 4 (chains A)
MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQI
LSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAK

Primary citation

pH-Driven Polymorphic Behaviour of the Third PDZ Domain of PSD95: The Role of Electrostatic Interactions. Salinas-Garcia, M.C., Plaza-Garrido, M., Gavira, J.A. et al. Crystals (Basel) (2023). DOI 10.3390/cryst13020218

Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TNG 0.95 Å, Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant
6QJL 1.04 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P21
6QJK 1.05 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
8AH7 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
3I4W 1.35 Å, Crystal Structure of the third PDZ domain of PSD-95
3K82 1.4 Å, Crystal Structure of the third PDZ domain of PSD-95
9TNF 1.45 Å, Crystal Structure of the third PDZ domain of PSD-95 protein Y397E mutant
8AH4 1.48 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at…
6QJF 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group…
6QJI 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
8AH8 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3121 at…
6QJD 1.55 Å, Crystal Structure of the truncated form of the third PDZ domain of PSD-95: residues…

Browse structure collections

About this viewer

MolViewer shows 8AH5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.