8AJB: Crescentin filaments
Cryo-EM structure of crescentin filaments (stutter mutant, C2 symmetry and large box). Determined by electron microscopy at 4.3 Å resolution. Released 16 Aug 2023.
- Method
- Electron microscopy
- Resolution
- 4.3 Å
- Organisms
- Caulobacter vibrioides, Camelidae
- Chains
- 24
- Atoms
- 30,088
- Mol. weight
- 1617.17 kDa
- Released
- 16 Aug 2023
Explore 8AJB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8AJB contains 34 α-helices and 84 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and M: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-60 | 25 | |
| α-helix | 63-68 | 6 | |
| α-helix | 71-82 | 12 | |
| α-helix | 86-276 | 191 | |
Chains B and N: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-276 | 236 | |
Chains C, D, O and P: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 214-445 | 232 | |
Chains E and Q: 2 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 791-793 | 3 | 1 |
| β-strand | 796 | 1 | 1 |
| β-strand | 807-810 | 4 | 2 |
| β-strand | 811-812 | 2 | 3 |
| α-helix | 817-818 | 2 | |
| β-strand | 820-824 | 5 | 2 |
| β-strand | 830-832 | 3 | 2 |
| β-strand | 841-845 | 5 | 1 |
| β-strand | 850-855 | 6 | 1 |
| α-helix | 860-862 | 3 | |
| β-strand | 864-866 | 3 | 3 |
| β-strand | 869-872 | 4 | 4 |
| β-strand | 875-878 | 4 | 4 |
| β-strand | 882-884 | 3 | 3 |
Chains F and R: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 5 |
| β-strand | 794-797 | 4 | 5 |
| β-strand | 807-812 | 6 | 6 |
| β-strand | 820-824 | 5 | 6 |
| β-strand | 831 | 1 | 6 |
| β-strand | 842-845 | 4 | 7 |
| β-strand | 850-853 | 4 | 7 |
| α-helix | 860-862 | 3 | |
| β-strand | 865-870 | 6 | 6 |
Chains G and S: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-192 | 153 | |
Chains H and T: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-192 | 161 | |
Chains I, J, U and V: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 328-445 | 118 | |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Crescentin | A, B, C, D, G, H, I, J, M, N, O, P, S, T, U, V | protein | 460 | Caulobacter vibrioides | A0A0H3CD98 (AlphaFold model) |
| Crescentin-specific megabody MB13 | E, F, K, L, Q, R, W, X | protein | 907 | Camelidae | |
Sequence of entity 1 (A, B, C, D, G, H, I, J, M, N, O, P, S, T, U, V), FASTA
>8AJB_1 Crescentin (chains A, B, C, D, G, H, I, J, M, N, O, P, S, T, U, V)
MRLLSKNSRETKNGKPTVLGDEARAEAMQHQIESTQAIGQRYETIHGGLDSIGRVMEHLK
AIEPLIAEIRGPVSQEFEARRAEHAELIAVRANLDQAQRQIALIQAEEREVSARLAAAET
ALGESDARRQTQDAALEDNALEIDRLRNALLQSDLKVSSLDASLRDATARIEHLVQDVEG
LRVQAQDIDARRGDAEAALARANQDNALLGEEAATLKKRVDQAGLDLARLSRIETDLEAQ
LAAERARVQAVENALAAHQADSGRTIRGLESQVEANRAEISALQTRLETATGRADKLEEM
NGQISARLADSSAQQKAVERRAGDLNVALERALDRIRALEEEADGLRQRHAGVDTARATA
IERADQLAKSAVAQEKALKRAEERAQQLRARLDAMQEAQDQVRRDSATHEAKIAELQATI
ERLTSEAALAEGALEAARRDRSRLQMALLGASDGDVAASA
Sequence of entity 2 (E, F, K, L, Q, R, W, X), FASTA
>8AJB_2 Crescentin-specific megabody MB13 (chains E, F, K, L, Q, R, W, X)
EVQLQESGGGLVYKEETQSGLNNYARVVEKGQYDSLEIPAQVAASWESGRDDAAVFGFID
KEQLDKYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQESVDQASYMYSDNHYLAEMATI
LGKPEEAKRYRQLAQQLADYINTCMFDPTTQFYYDVRIEDKPLANGCAGKPIVERGKGPE
GWSPLFNGAATQANADAVVKVMLDPKEFNTFVPLGTAALTNPAFGADIYWRGRVWVDQFW
FGLKGMERYGYRDDALKLADTFFRHAKGLTADGPIQENYNPLTGAQQGAPNFSWSAAHLY
MLYNDFFRKQASGGGSGGGGSGGGGSGNADNYKNVINRTGAPQYMKDYDYDDHQRFNPFF
DLGAWHGHLLPDGPNTMGGFPGVALLTEEYINFMASNFDRLTVWQDGKKVDFTLEAYSIP
GALVQKLTAKDVQVEMTLRFATPRTSLLETKITSNKPLDLVWDGELLEKLEAKEGKPLSD
KTIAGEYPDYQRKISATRDGLKVTFGKVRATWDLLTSGESEYQVHKSLPVQTEINGNRFT
SKAHINGSTTLYTTYSHLLTAQEVSKEQMQIRDILARPAFYLTASQQRWEEYLKKGLTNP
DATPEQTRVAVKAIETLNGNWRSPGGAVKFNTVTPSVTGRWFSGNQTWPWDTWKQAFAMA
HFNPDIAKENIRAVFSWQIQPGDSVRPQDVGFVPDLIAWNLSPERGGDGGNWNERNTKPS
LAAWSVMEVYNVTQDKTWVAEMYPKLVAYHDWWLRNRDHNGNGVPEYGATRDKAHNTESG
EMLFTVKKDSLRLSCASSRSIDGINIMRWYRQAPGKQRGMVAVVTGWGSTNYVDSVKGRF
IISRDSAKDTVYLQMNNLKPEDTAVYSCNAIYRGSEYWGQGTQVTVSSGENLYFQGSHHH
HHHHHHH
Primary citation
Filament structure and subcellular organization of the bacterial intermediate filament-like protein crescentin. Liu, Y., van den Ent, F., Lowe, J. Proc Natl Acad Sci U S A (2024) 121:e2309984121-e2309984121. DOI 10.1073/pnas.2309984121 · PubMed
Other PDB entries of the same protein (UniProt A0A0H3CD98 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8AFE 3.3 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C1 symmetry and small box)
- 8AFH 3.9 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C2, symmetry and small box)
- 8AHL 4.1 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C1 symmetry and large box)
- 8AFL 4.4 Å, Cryo-EM structure of crescentin filaments (wildtype, C1 symmetry and small box)
- 8AFM 4.8 Å, Cryo-EM structure of crescentin filaments (wildtype, C2 symmetry and small box)
- 8AIA 5.1 Å, Cryo-EM structure of crescentin filaments (wildtype, C1 symmetry and large box)
- 8AIX 5.8 Å, Cryo-EM structure of crescentin filaments (wildtype, C2 symmetry and large box)
Browse structure collections
About this viewer
MolViewer shows 8AJB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.