8AQH: NanoLuc-Y94A luciferase mutant

NanoLuc-Y94A luciferase mutant. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Aug 2023.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Oplophorus gracilirostris
Chains: 2
Atoms: 2,702
Mol. weight: 40.59 kDa
Released: 23 Aug 2023

Explore 8AQH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AQH contains 7 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-16	9	1
α-helix	18-25	8
α-helix	31-34	4
β-strand	41-47	7	1
β-strand	51-61	11	1
α-helix	70-76	7
β-strand	80-82	3	1
β-strand	87-94	8	1
β-strand	96-98	3	1
β-strand	105-109	5	1
β-strand	112-120	9	1
β-strand	125-131	7	1
β-strand	135-142	8	1
β-strand	148-155	8	1
β-strand	158-166	9	1

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-16	9	2
α-helix	18-24	7
α-helix	30-34	5
β-strand	40-47	8	2
β-strand	49	1	2
β-strand	51-60	10	2
α-helix	70-77	8
β-strand	80-84	5	2
β-strand	87-96	10	2
α-helix	104	1
β-strand	105-109	5	2
β-strand	112-120	9	2
β-strand	125-130	6	2
β-strand	136-143	8	2
β-strand	149-155	7	2
β-strand	158-166	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NanoLuc luciferase	A, B	protein	181	Oplophorus gracilirostris	Q9GV45 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8AQH_1 NanoLuc luciferase (chains A, B)
MHHHHHHSDNMVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSG
ENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHAGTLVIDGVTPNMID
YFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERIL
A

Primary citation

Illuminating the mechanism and allosteric behavior of NanoLuc luciferase. Nemergut, M., Pluskal, D., Horackova, J. et al. Nat Commun (2023) 14:7864-7864. DOI 10.1038/s41467-023-43403-y · PubMed

Other PDB entries of the same protein (UniProt Q9GV45 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SNS 1.55 Å, 1.55A Resolution Structure of NanoLuc Luciferase
8AQ6 1.69 Å, NanoLuc luciferase with bound furimamide in surface allosteric site
7VSX 1.7 Å, Crystal structure of QL-nanoKAZ (Reverse mutant of nanoKAZ with L18Q and V27L)
7SNX 1.7 Å, 1.70A Resolution Structure of NanoBiT Complementation Reporter Complex of LgBit and…
5B0U 1.71 Å, Crystal structure of the mutated 19 kDa protein of Oplophorus luciferase (nanoKAZ)
7SNW 1.8 Å, 1.80A Resolution Structure of NanoLuc Luciferase with Bound Inhibitor PC 16026576
5IBO 1.95 Å, 1.95A resolution structure of NanoLuc luciferase
8AQI 1.99 Å, NanoLuc luciferase with bound coelenteramide in surface allosteric site
7SNR 2.0 Å, 2.00A Resolution Structure of NanoLuc Luciferase
7SNY 2.1 Å, 2.10A Resolution Structure of NanoBiT Complementation Reporter Large Subunit LgBiT
7SNT 2.2 Å, 2.20A Resolution Structure of NanoLuc Luciferase with Bound Substrate Analog…
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1

Browse structure collections

About this viewer

MolViewer shows 8AQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.