8AQI: NanoLuc luciferase
NanoLuc luciferase with bound coelenteramide in surface allosteric site. Determined by X-ray diffraction at 1.99 Å resolution. Released 23 Aug 2023.
- Method
- X-ray diffraction
- Resolution
- 1.99 Å
- Organism
- Oplophorus gracilirostris
- Chains
- 8
- Atoms
- 11,291
- Mol. weight
- 165.05 kDa
- Ligands
- CEI
- Released
- 23 Aug 2023
Explore 8AQI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8AQI contains 40 α-helices and 94 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| β-strand | 8-16 | 9 | 1 |
| α-helix | 18-24 | 7 | |
| α-helix | 30-34 | 5 | |
| β-strand | 36-37 | 2 | 2 |
| β-strand | 41-47 | 7 | 1 |
| β-strand | 51-61 | 11 | 1 |
| α-helix | 69-77 | 9 | |
| β-strand | 81-84 | 4 | 1 |
| β-strand | 87-99 | 13 | 1 |
| β-strand | 105-109 | 5 | 1 |
| β-strand | 113-120 | 8 | 1 |
| β-strand | 124-130 | 7 | 1 |
| β-strand | 136-143 | 8 | 1 |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 158-166 | 9 | 1 |
Chain B: 7 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| β-strand | 8-16 | 9 | 3 |
| α-helix | 18-23 | 6 | |
| α-helix | 30-33 | 4 | |
| β-strand | 36-37 | 2 | 4 |
| β-strand | 40-47 | 8 | 3 |
| β-strand | 51-61 | 11 | 3 |
| α-helix | 69-71 | 3 | |
| α-helix | 74-77 | 4 | |
| β-strand | 81-84 | 4 | 3 |
| β-strand | 87-98 | 12 | 3 |
| α-helix | 104 | 1 | |
| β-strand | 105-109 | 5 | 3 |
| β-strand | 112-120 | 9 | 3 |
| β-strand | 125-130 | 6 | 3 |
| β-strand | 136-143 | 8 | 3 |
| β-strand | 149-154 | 6 | 3 |
| β-strand | 159-166 | 8 | 3 |
| α-helix | 167-168 | 2 | |
Chain C: 5 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-6 | 4 | |
| β-strand | 8-16 | 9 | 2 |
| α-helix | 18-23 | 6 | |
| α-helix | 30-32 | 3 | |
| β-strand | 36-37 | 2 | 1 |
| β-strand | 41-47 | 7 | 2 |
| β-strand | 51-61 | 11 | 2 |
| α-helix | 71-77 | 7 | |
| β-strand | 81-84 | 4 | 2 |
| β-strand | 87-99 | 13 | 2 |
| β-strand | 105-109 | 5 | 2 |
| β-strand | 112-120 | 9 | 2 |
| β-strand | 125-130 | 6 | 2 |
| β-strand | 136-143 | 8 | 2 |
| β-strand | 149-155 | 7 | 2 |
| β-strand | 158-166 | 9 | 2 |
| α-helix | 167-168 | 2 | |
Chain D: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-6 | 3 | |
| β-strand | 8-16 | 9 | 4 |
| α-helix | 18-24 | 7 | |
| α-helix | 30-33 | 4 | |
| β-strand | 36-37 | 2 | 3 |
| β-strand | 41-47 | 7 | 4 |
| β-strand | 51-61 | 11 | 4 |
| α-helix | 73-76 | 4 | |
| β-strand | 81-84 | 4 | 4 |
| β-strand | 87-99 | 13 | 4 |
| β-strand | 105-109 | 5 | 4 |
| β-strand | 112-120 | 9 | 4 |
| β-strand | 124-130 | 7 | 4 |
| β-strand | 136-143 | 8 | 4 |
| β-strand | 149-155 | 7 | 4 |
| β-strand | 158-166 | 9 | 4 |
Chain E: 4 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-16 | 9 | 5 |
| α-helix | 18-25 | 8 | |
| α-helix | 30-34 | 5 | |
| β-strand | 41-46 | 6 | 5 |
| β-strand | 51-61 | 11 | 5 |
| α-helix | 67-77 | 11 | |
| β-strand | 81-84 | 4 | 5 |
| β-strand | 87-98 | 12 | 5 |
| α-helix | 103-104 | 2 | |
| β-strand | 105-106 | 2 | 5 |
| β-strand | 108-109 | 2 | 5 |
| β-strand | 112 | 1 | 5 |
| β-strand | 115-120 | 6 | 5 |
| β-strand | 124-130 | 7 | 5 |
| β-strand | 136-143 | 8 | 5 |
| β-strand | 149-155 | 7 | 5 |
| β-strand | 159-166 | 8 | 5 |
Chain F: 6 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| β-strand | 8-16 | 9 | 6 |
| α-helix | 18-24 | 7 | |
| α-helix | 31-34 | 4 | |
| β-strand | 41-47 | 7 | 6 |
| β-strand | 51-61 | 11 | 6 |
| α-helix | 74-77 | 4 | |
| β-strand | 81-84 | 4 | 6 |
| β-strand | 87-99 | 13 | 6 |
| β-strand | 105-109 | 5 | 6 |
| β-strand | 112-120 | 9 | 6 |
| β-strand | 124-130 | 7 | 6 |
| α-helix | 135 | 1 | |
| β-strand | 136-143 | 8 | 6 |
| β-strand | 149-155 | 7 | 6 |
| β-strand | 158-166 | 9 | 6 |
| α-helix | 167-168 | 2 | |
Chain G: 6 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| β-strand | 8-16 | 9 | 7 |
| α-helix | 18-24 | 7 | |
| α-helix | 30-34 | 5 | |
| β-strand | 40-47 | 8 | 7 |
| β-strand | 51-61 | 11 | 7 |
| α-helix | 69-76 | 8 | |
| β-strand | 81-84 | 4 | 7 |
| β-strand | 87-98 | 12 | 7 |
| α-helix | 104 | 1 | |
| β-strand | 105-109 | 5 | 7 |
| β-strand | 112-120 | 9 | 7 |
| β-strand | 124-130 | 7 | 7 |
| β-strand | 136-143 | 8 | 7 |
| β-strand | 149-155 | 7 | 7 |
| β-strand | 158-166 | 9 | 7 |
| α-helix | 167-168 | 2 | |
Chain H: 4 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| β-strand | 8-16 | 9 | 8 |
| α-helix | 18-24 | 7 | |
| β-strand | 41-47 | 7 | 8 |
| β-strand | 51-61 | 11 | 8 |
| α-helix | 80-81 | 2 | |
| β-strand | 82-84 | 3 | 8 |
| β-strand | 87-98 | 12 | 8 |
| β-strand | 105-109 | 5 | 8 |
| β-strand | 112-120 | 9 | 8 |
| β-strand | 125-130 | 6 | 8 |
| α-helix | 135 | 1 | |
| β-strand | 136-143 | 8 | 8 |
| β-strand | 149-155 | 7 | 8 |
| β-strand | 158-166 | 9 | 8 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| NanoLuc luciferase | A, B, C, D, E, F, G, H | protein | 181 | Oplophorus gracilirostris | Q9GV45 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>8AQI_1 NanoLuc luciferase (chains A, B, C, D, E, F, G, H)
MHHHHHHSDNMVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSG
ENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMID
YFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERIL
A
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CEI | N-[3-benzyl-5-(4-hydroxyphenyl)pyrazin-2-yl]-2-(4-hydroxyphenyl)acetamide | C25 H21 N3 O3 | 2 |
Water and common crystallization additives (CL, PG4) are not listed.
Primary citation
Illuminating the mechanism and allosteric behavior of NanoLuc luciferase. Nemergut, M., Pluskal, D., Horackova, J. et al. Nat Commun (2023) 14:7864-7864. DOI 10.1038/s41467-023-43403-y · PubMed
Other PDB entries of the same protein (UniProt Q9GV45 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7SNS 1.55 Å, 1.55A Resolution Structure of NanoLuc Luciferase
- 8AQ6 1.69 Å, NanoLuc luciferase with bound furimamide in surface allosteric site
- 7VSX 1.7 Å, Crystal structure of QL-nanoKAZ (Reverse mutant of nanoKAZ with L18Q and V27L)
- 7SNX 1.7 Å, 1.70A Resolution Structure of NanoBiT Complementation Reporter Complex of LgBit and…
- 5B0U 1.71 Å, Crystal structure of the mutated 19 kDa protein of Oplophorus luciferase (nanoKAZ)
- 7SNW 1.8 Å, 1.80A Resolution Structure of NanoLuc Luciferase with Bound Inhibitor PC 16026576
- 5IBO 1.95 Å, 1.95A resolution structure of NanoLuc luciferase
- 7SNR 2.0 Å, 2.00A Resolution Structure of NanoLuc Luciferase
- 7SNY 2.1 Å, 2.10A Resolution Structure of NanoBiT Complementation Reporter Large Subunit LgBiT
- 7SNT 2.2 Å, 2.20A Resolution Structure of NanoLuc Luciferase with Bound Substrate Analog…
- 9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
- 8AQH 2.8 Å, NanoLuc-Y94A luciferase mutant
Browse structure collections
About this viewer
MolViewer shows 8AQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.