Anaplastic Lymphoma Kinase with a novel carboline inhibitor. Determined by X-ray diffraction at 1.65 Å resolution. Released 14 Sept 2022.
Explore 8ARJ in 3D Show helices and sheets RCSB PDB PDBe
8ARJ contains 20 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1109 | 1 | |
| β-strand | 1110 | 1 | 1 |
| α-helix | 1111-1112 | 2 | |
| α-helix | 1113-1115 | 3 | |
| β-strand | 1117-1123 | 7 | 1 |
| β-strand | 1130-1134 | 5 | 1 |
| β-strand | 1146-1152 | 7 | 1 |
| α-helix | 1158-1172 | 15 | |
| β-strand | 1179 | 1 | 2 |
| α-helix | 1180-1181 | 2 | |
| β-strand | 1182-1186 | 5 | 1 |
| β-strand | 1192-1196 | 5 | 1 |
| β-strand | 1202-1203 | 2 | 2 |
| α-helix | 1204-1210 | 7 | |
| α-helix | 1223-1242 | 20 | |
| α-helix | 1252-1254 | 3 | |
| β-strand | 1255-1257 | 3 | 2 |
| β-strand | 1266-1268 | 3 | 2 |
| α-helix | 1273-1276 | 4 | |
| α-helix | 1293-1295 | 3 | |
| α-helix | 1298-1303 | 6 | |
| α-helix | 1308-1323 | 16 | |
| α-helix | 1327-1328 | 2 | |
| α-helix | 1335-1343 | 9 | |
| α-helix | 1348-1351 | 4 | |
| α-helix | 1356-1365 | 10 | |
| α-helix | 1370-1372 | 3 | |
| α-helix | 1376-1388 | 13 | |
| α-helix | 1390-1393 | 4 | |
| α-helix | 1395-1398 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ALK tyrosine kinase receptor | A | protein | 321 | Homo sapiens | Q9UM73 (AlphaFold model) |
>8ARJ_1 ALK tyrosine kinase receptor (chains A) GSNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVK TLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRE TRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGD FGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPY PSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDP DVINTALPIEYGPLVEEEEKV
| ID | Name | Formula | Copies |
|---|---|---|---|
| NRR | 3-(dimethylamino)-1-[3-[4-(4-methylpiperazin-1-yl)phenyl]-9~{H}-pyrido[2,3-b]in… | C27 H29 N5 O | 1 |
Discovery of Novel alpha-Carboline Inhibitors of the Anaplastic Lymphoma Kinase. Mologni, L., Tardy, S., Zambon, A. et al. ACS Omega (2022) 7:17083-17097. DOI 10.1021/acsomega.2c00507 · PubMed
Other PDB entries of the same protein (UniProt Q9UM73 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ARJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.