8BQV: Alpha-synuclein
Cryo-EM structure of alpha-synuclein singlet filament from Juvenile-onset synucleinopathy. Determined by electron microscopy at 2.0 Å resolution. Released 22 Feb 2023.
- Method
- Electron microscopy
- Resolution
- 2.0 Å
- Organism
- Homo sapiens
- Chains
- 2
- Atoms
- 573
- Mol. weight
- 15.09 kDa
- Released
- 22 Feb 2023
Explore 8BQV in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Alpha-synuclein | A | protein | 140 | Homo sapiens | P37840 (AlphaFold model) |
| Unknown protein | C | protein | 7 | Homo sapiens | |
Sequence of entity 1 (A), FASTA
>8BQV_1 Alpha-synuclein (chains A)
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
Sequence of entity 2 (C), FASTA
>8BQV_2 Unknown protein (chains C)
XXXXXXX
Primary citation
New SNCA mutation and structures of alpha-synuclein filaments from juvenile-onset synucleinopathy. Yang, Y., Garringer, H.J., Shi, Y. et al. Acta Neuropathol (2023) 145:561-572. DOI 10.1007/s00401-023-02550-8 · PubMed
Other PDB entries of the same protein (UniProt P37840 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8JJV 1.23 Å, Structure of truncated form of nanobody in complex with alpha-synuclein peptide
- 8JLY 1.29 Å, Structure of nanobody in complex with alpha-synuclein peptide
- 3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
- 4R0U 1.38 Å, Tgvtava, an amyloid forming segment from alpha synuclein, residues 72-78
- 6I42 1.38 Å, Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex
- 4ZNN 1.41 Å, MicroED structure of the segment, GVVHGVTTVA, from the A53T familial mutant of…
- 4RIL 1.43 Å, Structure of the amyloid forming segment, GAVVTGVTAVA, from the NAC domain of…
- 4R0W 1.5 Å, Vvtgvta, an amyloid forming segment from alpha synuclein, residues 70-76
- 3Q26 1.54 Å, Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (MBP)
- 3Q28 1.6 Å, Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (MBP)
- 5CRW 1.6 Å, Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed…
- 2X6M 1.62 Å, Structure of a single domain camelid antibody fragment in complex with a C-terminal…
Browse structure collections
About this viewer
MolViewer shows 8BQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.