Crystal structure of the IBR-RING2 domain of HOIL-1. Determined by X-ray diffraction at 2.24 Å resolution. Released 18 Jan 2023.
Explore 8BVL in 3D Show helices and sheets RCSB PDB PDBe
8BVL contains 8 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 368-370 | 3 | 1 |
| β-strand | 379-381 | 3 | 1 |
| β-strand | 383 | 1 | 2 |
| β-strand | 386 | 1 | 2 |
| β-strand | 388-390 | 3 | 3 |
| α-helix | 396 | 1 | |
| β-strand | 397-399 | 3 | 3 |
| β-strand | 404 | 1 | 3 |
| α-helix | 411-420 | 10 | |
| α-helix | 426-440 | 15 | |
| β-strand | 444-446 | 3 | 4 |
| β-strand | 453-455 | 3 | 4 |
| β-strand | 462-464 | 3 | 5 |
| β-strand | 471-473 | 3 | 5 |
| β-strand | 478-479 | 2 | 5 |
| α-helix | 497-499 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 368-370 | 3 | 6 |
| β-strand | 379-381 | 3 | 6 |
| β-strand | 383 | 1 | 7 |
| β-strand | 386 | 1 | 7 |
| β-strand | 388-390 | 3 | 8 |
| α-helix | 396 | 1 | |
| β-strand | 397-399 | 3 | 8 |
| β-strand | 404 | 1 | 8 |
| α-helix | 411-419 | 9 | |
| α-helix | 426-440 | 15 | |
| β-strand | 444-446 | 3 | 9 |
| β-strand | 453-455 | 3 | 9 |
| β-strand | 462-464 | 3 | 10 |
| β-strand | 471-473 | 3 | 10 |
| β-strand | 478-479 | 2 | 10 |
| α-helix | 497-499 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RanBP-type and C3HC4-type zinc finger-containing protein 1 | A, B | protein | 145 | Homo sapiens | Q9BYM8 (AlphaFold model) |
>8BVL_1 RanBP-type and C3HC4-type zinc finger-containing protein 1 (chains A, B) GPSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQND VAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGG PGDTSGGCRCRVNGIPCHPSCQNCH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 10 |
Structural basis for ubiquitylation by HOIL-1. Wu, Q., Koliopoulos, M.G., Rittinger, K. et al. Front Mol Biosci (2022) 9:1098144-1098144. DOI 10.3389/fmolb.2022.1098144 · PubMed
Other PDB entries of the same protein (UniProt Q9BYM8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8BVL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.