8BWH: Small molecule stabilizer for 14-3-3/ChREBP

Small molecule stabilizer for 14-3-3/ChREBP (Cmd 42). Determined by X-ray diffraction at 2.1 Å resolution. Released 1 May 2024.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,192
Mol. weight: 29.39 kDa
Ligands: MG, XSL
Released: 1 May 2024

Explore 8BWH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BWH contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-37	4
α-helix	38-68	31
α-helix	80-102	23
α-helix	103-107	5
α-helix	114-134	21
α-helix	137-161	25
α-helix	167-182	16
α-helix	187-203	17
α-helix	205-207	3
α-helix	213-230	18

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	118-133	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein sigma	A	protein	236	Homo sapiens	P31947 (AlphaFold model)
Carbohydrate-responsive element-binding protein	B	protein	18	Homo sapiens	Q9NP71 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8BWH_1 14-3-3 protein sigma (chains A)
GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ
RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE
SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN
FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (B), FASTA

>8BWH_2 Carbohydrate-responsive element-binding protein (chains B)
RDKIRLNNAIWRAWYIQY

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
XSL	[2-[2-[[2,2-bis(fluoranyl)-2-(2-fluorophenyl)ethyl]amino]-2-oxidanylidene-ethox…	C16 H15 F3 N O5 P	1

Primary citation

Molecular glues of the regulatory ChREBP/14-3-3 complex protect beta cells from glucolipotoxicity. Katz, L.S., Visser, E.J., Plitzko, K.F. et al. bioRxiv (2024). DOI 10.1101/2024.02.16.580675 · PubMed

Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IQU 1.05 Å, Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer)
7AZ2 1.08 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound LvD1014
6HMT 1.1 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C42 mutant bound to…
7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
9GG8 1.1 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS214 peptide and…
8ANC 1.11 Å, 14-3-3 sigma sirtuin-3 phospho-peptide complex
6Y1J 1.13 Å, 14-3-3 sigma in complex with IkappaBalpha pS63 peptide
6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
6NV2 1.13 Å, 14-3-3 sigma with RelA/p65 binding site pS45 in complex with DP005

Browse structure collections

About this viewer

MolViewer shows 8BWH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.