8CDY: N-terminal domain of human apolipoprotein E

N-terminal domain of human apolipoprotein E. Determined by X-ray diffraction at 1.9 Å resolution. Released 19 Jul 2023.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 1,261
Mol. weight: 75.12 kDa
Released: 19 Jul 2023

Explore 8CDY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CDY contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	25-42	18
α-helix	45-52	8
α-helix	55-78	24
α-helix	88-123	36
α-helix	131-162	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltodextrin-binding protein,Apolipoprotein E	A	protein	675	Escherichia coli, Homo sapiens	P02649 (AlphaFold model), P0AEX9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8CDY_1 Maltodextrin-binding protein,Apolipoprotein E (chains A)
GPMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGP
DIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY
NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYD
IKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDT
SAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDK
PLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTV
DAALAAAQTNAAAAHMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLS
EQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARL
GADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
GAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSR
TRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAAQARLKSRFEPLAEDMQRQWAGQVEKVQ
AAEGTSAAPVPSDNH

Primary citation

Domino-like effect of C112R mutation on ApoE4 aggregation and its reduction by Alzheimer's Disease drug candidate. Nemergut, M., Marques, S.M., Uhrik, L. et al. Mol Neurodegener (2023) 18:38-38. DOI 10.1186/s13024-023-00620-9 · PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)

Browse structure collections

About this viewer

MolViewer shows 8CDY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.