8CGH: TDP-43 amyloid filament from type A FTLD-TDP

Structure of TDP-43 amyloid filament from type A FTLD-TDP (variant 3). Determined by electron microscopy at 2.68 Å resolution. Released 2 Aug 2023.

Method: Electron microscopy
Resolution: 2.68 Å
Organism: Homo sapiens
Chains: 5
Atoms: 2,710
Mol. weight: 223.92 kDa
Released: 2 Aug 2023

Explore 8CGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CGH contains 0 α-helices and 70 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and U: 0 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	283	1	1
β-strand	286	1	2
β-strand	289	1	3
β-strand	297-303	7	4
β-strand	306-308	3	5
β-strand	311-318	8	6
β-strand	321-327	7	7
β-strand	330-331	2	8
β-strand	334-336	3	9
β-strand	339	1	10
β-strand	342-347	6	11
β-strand	350	1	12
β-strand	353-355	3	13
β-strand	359	1	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TAR DNA-binding protein 43	A, B, C, D, U	protein	414	Homo sapiens	Q13148 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, U), FASTA

>8CGH_1 TAR DNA-binding protein 43 (chains A, B, C, D, U)
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

Primary citation

TDP-43 forms amyloid filaments with a distinct fold in type A FTLD-TDP. Arseni, D., Chen, R., Murzin, A.G. et al. Nature (2023) 620:898-903. DOI 10.1038/s41586-023-06405-w · PubMed

Other PDB entries of the same protein (UniProt Q13148 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CF4 0.75 Å, Segment NFGTFS, with familial mutation A315T and phosphorylated threonine, from the low…
5WHP 1.0 Å, Crystal structure of the segment, NFGTFS, from the A315T familial variant of the low…
5WKB 1.0 Å, MicroED structure of the segment, NFGEFS, from the A315E familial variant of the low…
5WIA 1.0 Å, Crystal structure of the segment, GNNSYS, from the low complexity domain of TDP-43,…
5WHN 1.1 Å, Crystal structure of the segment, NFGAFS, from the low complexity domain of TDP-43,…
5WIQ 1.25 Å, Crystal structure of the segment, GFNGGFG, from the low complexity domain of TDP-43,…
5W50 1.4 Å, Crystal structure of the segment, LIIKGI, from the RRM2 of TDP-43, residues 248-253
5W52 1.4 Å, MicroED structure of the segment, DLIIKGISVHI, from the RRM2 of TDP-43, residues 247-257
6CFH 1.5 Å, SWGMMGMLASQ segment from the low complexity domain of TDP-43
5WKD 1.8 Å, Crystal structure of the segment, GNNQGSN, from the low complexity domain of TDP-43,…
5MDI 2.1 Å, Crystal structure of TDP-43 N-terminal domain at 2.1 A resolution
7N9H 2.2 Å, Structure of the mammalian importin a1 bound to the TDP-43 NLS

Browse structure collections

About this viewer

MolViewer shows 8CGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.