Human FKBP12 in complex with (1S,5S,6R)-9-((3,5-dichlorophenyl)sulfonyl)-3-(pyridin-2-ylmethyl)-5-vinyl-3,9-diazabicyclo[4.2.1]nonan-2-one. Determined by X-ray diffraction at 1.4 Å resolution. Released 6 Sept 2023.
Explore 8CHL in 3D Show helices and sheets RCSB PDB PDBe
8CHL contains 5 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 21-30 | 10 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 44-45 | 2 | |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 57-63 | 7 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 3 |
| β-strand | 22-30 | 9 | 3 |
| β-strand | 35-38 | 4 | 3 |
| β-strand | 46-48 | 3 | 3 |
| α-helix | 57-63 | 7 | |
| β-strand | 71-76 | 6 | 3 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 4 |
| β-strand | 91 | 1 | 4 |
| β-strand | 97-106 | 10 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase FKBP1A | A, B | protein | 107 | Homo sapiens | P62942 (AlphaFold model) |
>8CHL_1 Peptidyl-prolyl cis-trans isomerase FKBP1A (chains A, B) GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
| ID | Name | Formula | Copies |
|---|---|---|---|
| USV | (1~{S},5~{S},6~{R})-10-[3,5-bis(chloranyl)phenyl]sulfonyl-5-ethenyl-3-(pyridin-… | C22 H23 Cl2 N3 O3 S | 2 |
| CD | Cadmium ion | Cd | 7 |
Water and common crystallization additives (DMS, GOL, SO4) are not listed.
Deconstructing Protein Binding of Sulfonamides and Sulfonamide Analogues. Purder, P.L., Meyners, C., Sugiarto, W.O. et al. JACS Au (2023) 3:2478-2486. DOI 10.1021/jacsau.3c00241 · PubMed
Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.