8CYL: Ast89 P domain

Ast89 P domain. Determined by X-ray diffraction at 1.89 Å resolution. Released 19 Oct 2022.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Lagovirus
Chains: 2
Atoms: 5,333
Mol. weight: 69.6 kDa
Released: 19 Oct 2022

Explore 8CYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CYL contains 20 α-helices and 72 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 10 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	239-242	4
α-helix	245-248	4
β-strand	253	1	1
β-strand	254	1	2
α-helix	259	1
β-strand	260	1	1
β-strand	261-266	6	3
β-strand	271-272	2	4
β-strand	294-303	10	5
β-strand	310	1	6
β-strand	315-319	5	5
β-strand	339	1	7
β-strand	340	1	5
α-helix	349-350	2
β-strand	354-361	8	5
β-strand	368	1	5
α-helix	370-372	3
β-strand	374-382	9	5
β-strand	389-390	2	5
β-strand	393	1	8
β-strand	398-403	6	5
β-strand	409	1	6
β-strand	416-421	6	5
β-strand	425-426	2	5
β-strand	437	1	3
α-helix	440-442	3
β-strand	443	1	7
β-strand	445	1	8
α-helix	449-450	2
β-strand	451-452	2	4
β-strand	455	1	9
β-strand	458	1	9
β-strand	459-466	8	3
β-strand	469	1	5
β-strand	472	1	5
β-strand	485-488	4	3
β-strand	491	1	2
α-helix	492-500	9
β-strand	511-519	9	3
β-strand	522-528	7	3
β-strand	534-536	3	3
α-helix	543-544	2
β-strand	545-546	2	3
β-strand	550-560	11	3
α-helix	564-566	3
β-strand	567-568	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein VP60	A	protein	339	Lagovirus	Q86119
Capsid protein VP60	B	protein	333	Lagovirus	Q86119

Sequence of entity 1 (A), FASTA

>8CYL_1 Capsid protein VP60 (chains A)
SKTVDSISPAGLLTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNLNGSTYGWSSP
RFADIDHRRGSASYPGNNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIP
AAGWVGFGAIWNSNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGSQTVAKSIYAVVTG
TAQNPAGLFVMASGVISTPSANAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRT
GDVNATAGSANGTQYGTGSQPLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSV
DGYFYAGTGASTTLIDLTELIDVRPVGPRPSKSTLVFNL

Sequence of entity 2 (B), FASTA

>8CYL_2 Capsid protein VP60 (chains B)
ISPAGLLTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNLNGSTYGWSSPRFADID
HRRGSASYPGNNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIPAAGWVG
FGAIWNSNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGSQTVAKSIYAVVTGTAQNPA
GLFVMASGVISTPSANAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRTGDVNAT
AGSANGTQYGTGSQPLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSVDGYFYA
GTGASTTLIDLTELIDVRPVGPRPSKSTLVFNL

Primary citation

Structural Basis for Rabbit Hemorrhagic Disease Virus Antibody Specificity. Leuthold, M.M., Kilic, T., Devant, J.M. et al. J Virol (2022) 96:e0121722-e0121722. DOI 10.1128/jvi.01217-22 · PubMed

Other PDB entries of the same protein (UniProt Q86119), best resolution first:

9I3H 2.5 Å, CP of RHDV mutant - N15
9I8J 2.9 Å, AB Spike of RHDV mutant N15
9I3E 3.0 Å, CP of RHDV mutant - 29N
9I90 3.2 Å, CP of empty RHDV virion
9I8R 3.3 Å, CP of RHDV VLP (VP1)
9I9D 3.3 Å, CP of RHDV virion (full particle)
3ZUE 10.3 Å, Rabbit Hemorrhagic Disease Virus (RHDV)capsid protein

Browse structure collections

About this viewer

MolViewer shows 8CYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.